KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103013608
Entry
103013608         CDS       T03086                                 

Gene name
SYK
Definition
(RefSeq) spleen associated tyrosine kinase
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04064  NF-kappa B signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04380  Osteoclast differentiation
bacu04611  Platelet activation
bacu04625  C-type lectin receptor signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu05152  Tuberculosis
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05171  Coronavirus disease - COVID-19
bacu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103013608 (SYK)
   04072 Phospholipase D signaling pathway
    103013608 (SYK)
   04151 PI3K-Akt signaling pathway
    103013608 (SYK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103013608 (SYK)
   04625 C-type lectin receptor signaling pathway
    103013608 (SYK)
   04650 Natural killer cell mediated cytotoxicity
    103013608 (SYK)
   04662 B cell receptor signaling pathway
    103013608 (SYK)
   04664 Fc epsilon RI signaling pathway
    103013608 (SYK)
   04666 Fc gamma R-mediated phagocytosis
    103013608 (SYK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103013608 (SYK)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103013608 (SYK)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103013608 (SYK)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    103013608 (SYK)
   05168 Herpes simplex virus 1 infection
    103013608 (SYK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103013608 (SYK)
   05169 Epstein-Barr virus infection
    103013608 (SYK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103013608 (SYK)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     103013608 (SYK)
Protein kinases [BR:bacu01001]
 Non-receptor tyrosine kinases
  SYK family
   103013608 (SYK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 Kdo RIO1
Other DBs
NCBI-GeneID: 103013608
NCBI-ProteinID: XP_007193481
UniProt: A0A384B1B1
LinkDB
Position
Un
AA seq 626 aa
MGDSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHDRKAHHYT
IERELNGTYAISGGRAHGSPAELCHYHSQELDGLICLLKKPFNRPPGVQPKTGPFEDLKE
NLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISRDESEQIVLIG
SKTNGKFLIRSRDNGSYALCLLHEGKVLHYRIDKDKTGKLSIPGGKNFDTLWQLVEHYSY
KSDGLLRVLTVPCQKFDGQMGNINFRPQLPSSHPVTWSAGGIISRIKSYSFPKPGHRKGS
SSQRPESSVTFNPYEPDRGPWANEREAQREALPMDTEVYESPYADPEEIRPKEVYLDRKL
LTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDN
PYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEECN
FVHRDLAARNVLLVTQHYAKISDFGLSKALHADENYYKAQTHGKWPVKWYAPECINYYKF
SSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVSAMLEKGERMGCPPGCPREMYELMTLCW
TYDVENRPGFVAVELRLRNYYYDVVN
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgggcgacagcgctaaccacctgcccttcttcttcggcaacatcacccgggaggaggca
gaagactacctggtccaggggggcatgagcgacgggctctacctgctgcgccagagccgc
aactacctgggcggcttcgccctgtcggtggcgcacgaccggaaggcgcatcactacacc
atcgagcgggagctaaacgggacctacgccatctcgggcggcagggcccacggcagcccc
gccgagctttgccactaccactcccaggagctggatggcctcatctgcctcctcaagaag
cccttcaaccggccgcccggggtgcagcccaaaaccggcccctttgaggacctgaaggag
aacctcatccgggagtatgtgaaacagacgtggaacctacagggtcaagctctcgagcag
gccattatcagccagaaacctcagctggagaagctgatcgccaccacagcccatgaaaaa
atgccctggttccacggaaaaatctctcgggatgaatctgagcagattgttctgatagga
tcaaagacaaatggaaagtttttgatcaggtccagggacaacgggtcttatgccctgtgc
ctgctgcacgaggggaaggtgctgcactaccgcatcgataaggacaaaacggggaagctc
tccatccctggtgggaagaatttcgacacgctctggcagctcgtcgagcattattcttat
aagtcagatggtttgttaagagttcttacagttccatgtcaaaaatttgatggtcaaatg
ggaaatattaatttccgtccacaacttccaagttcccatcctgtgacttggtcagcgggt
ggaataatctcaagaatcaaatcgtactccttcccaaagcctggccacagaaagggctcc
tcatcccaaaggccagaaagttcggtgacgttcaacccttatgagccagaccgagggccc
tgggccaacgaaagagaagcccagagagaagccttgcccatggacaccgaggtctatgaa
agcccctatgcagaccccgaggagatcaggcctaaagaggtctacctagaccggaagctg
ctgaccctggaggacaaggaactgggctctgggaactttgggacagtgaagaagggctac
taccagatgaagaaagttgtgaaaacagtggctgtgaaaatcctgaaaaacgaggccaat
gaccccgctcttaaagatgagttattagcagaagcaaacgtcatgcagcaactcgacaac
ccttacattgtgcgcatgattgggatatgcgaagccgagtcctggatgctggttatggag
atggcggaacttggtccactcaacaaatatttacagcagaacaggcatgtcaaggataag
aacatcatagagctggttcatcaggtgtctatgggaatgaaatatttggaagagtgcaat
tttgtgcacagagatctggctgcaaggaatgtattgctggttactcaacattatgccaag
atcagtgattttggactttccaaagcacttcatgctgatgaaaactactacaaggcccag
acccacgggaagtggcccgtgaagtggtacgctccggaatgcatcaactactacaagttc
tccagcaagagtgatgtctggagctttggagtattaatgtgggaagcattttcctacggg
cagaagccatatcggggaatgaaaggcagcgaagtttctgctatgctggagaaaggagag
aggatggggtgccctccagggtgtccgagagagatgtatgagctgatgaccctgtgctgg
acctatgacgtggagaacaggcccggatttgtagcagtggaactgcggctgcgcaattac
tactacgatgtggttaactaa

DBGET integrated database retrieval system