KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103013636
Entry
103013636         CDS       T03086                                 

Gene name
BID
Definition
(RefSeq) BH3 interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01524  Platinum drug resistance
bacu04071  Sphingolipid signaling pathway
bacu04115  p53 signaling pathway
bacu04210  Apoptosis
bacu04215  Apoptosis - multiple species
bacu04217  Necroptosis
bacu04650  Natural killer cell mediated cytotoxicity
bacu04932  Non-alcoholic fatty liver disease
bacu05010  Alzheimer disease
bacu05014  Amyotrophic lateral sclerosis
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    103013636 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103013636 (BID)
   04215 Apoptosis - multiple species
    103013636 (BID)
   04217 Necroptosis
    103013636 (BID)
   04115 p53 signaling pathway
    103013636 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103013636 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103013636 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103013636 (BID)
   05014 Amyotrophic lateral sclerosis
    103013636 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    103013636 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103013636 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103013636 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103013636 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103013636 (BID)
   05161 Hepatitis B
    103013636 (BID)
   05160 Hepatitis C
    103013636 (BID)
   05164 Influenza A
    103013636 (BID)
   05162 Measles
    103013636 (BID)
   05168 Herpes simplex virus 1 infection
    103013636 (BID)
   05163 Human cytomegalovirus infection
    103013636 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103013636 (BID)
   05169 Epstein-Barr virus infection
    103013636 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103013636 (BID)
SSDB
Motif
Pfam: BID
Other DBs
NCBI-GeneID: 103013636
NCBI-ProteinID: XP_007178695
UniProt: A0A383ZU89
LinkDB
Position
Un
AA seq 192 aa
MDSKVSNGASPQDERTTSLLVFAFLQSCPRSRCHQELEVLGHKLPVRAAHDDELQTDGNW
CSHFREGAAETDSETQEEVVRDIARQLAQIGDRMECSIRPGLVAGLAAQFRNRSLSEEDR
RRCLAAALEQLMQLYPADVDHEKTLLLLTMLVAKKVADHSPALLQDVFHTTVTFINQNLL
AYVRNLVQNEMD
NT seq 579 nt   +upstreamnt  +downstreamnt
atggactcgaaggtcagcaacggcgccagcccccaggacgagcgcaccacaagcctgctg
gtgttcgccttcctccagagctgcccgcgctcccgctgccaccaagagctggaggtgctg
ggccacaagctgcccgtgcgcgcggcccacgacgatgagctgcagacggatggcaactgg
tgcagccacttccgtgagggggcggcagagacagactctgagactcaggaggaagtggtc
cgggacatcgccaggcagctcgcccagattggggacaggatggagtgcagcatccgcccg
gggctggtggctggcctggccgcgcagttcaggaacaggagcctgtcggaggaggacagg
aggcggtgcctggcggccgcgctggaacaactcatgcagctctaccctgcggacgtggac
cacgagaagaccctgctcctgctgaccatgctcgtggccaaaaaggtggccgaccactcg
ccagctttgctccaagatgtctttcacaccacagtgaccttcatcaaccagaaccttctc
gcctacgtgaggaacttagtccaaaacgagatggactga

DBGET integrated database retrieval system