KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103013781
Entry
103013781         CDS       T03086                                 

Definition
(RefSeq) signal transducer and activator of transcription 1-like
  KO
K11220  signal transducer and activator of transcription 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04062  Chemokine signaling pathway
bacu04217  Necroptosis
bacu04380  Osteoclast differentiation
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04630  JAK-STAT signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04917  Prolactin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04935  Growth hormone synthesis, secretion and action
bacu05140  Leishmaniasis
bacu05145  Toxoplasmosis
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05212  Pancreatic cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103013781
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103013781
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103013781
   04621 NOD-like receptor signaling pathway
    103013781
   04625 C-type lectin receptor signaling pathway
    103013781
   04658 Th1 and Th2 cell differentiation
    103013781
   04659 Th17 cell differentiation
    103013781
   04062 Chemokine signaling pathway
    103013781
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103013781
   04935 Growth hormone synthesis, secretion and action
    103013781
   04919 Thyroid hormone signaling pathway
    103013781
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103013781
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103013781
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103013781
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103013781
  09163 Immune disease
   05321 Inflammatory bowel disease
    103013781
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103013781
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103013781
  09172 Infectious disease: viral
   05161 Hepatitis B
    103013781
   05160 Hepatitis C
    103013781
   05171 Coronavirus disease - COVID-19
    103013781
   05164 Influenza A
    103013781
   05162 Measles
    103013781
   05168 Herpes simplex virus 1 infection
    103013781
   05167 Kaposi sarcoma-associated herpesvirus infection
    103013781
   05169 Epstein-Barr virus infection
    103013781
   05165 Human papillomavirus infection
    103013781
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103013781
   05140 Leishmaniasis
    103013781
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103013781
Transcription factors [BR:bacu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103013781
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 TRPM_tetra
Other DBs
NCBI-GeneID: 103013781
NCBI-ProteinID: XP_007171518
UniProt: A0A383Z8K7
LinkDB
Position
Un
AA seq 749 aa
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIICNCLKEERKILENAQ
RFNQAQAGNIQNTVMLDKQKELDSRVRNVKDKVMCIEHEIKTLEDLQDEYDFKCKTLQNR
EHETNGVAKNDQKQEQMLLQKMYLMLDNKRKEVVHKIIELLNATELTQKALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQA
LSDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVSFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGARTN
EGPLIVTEELHSLSFETQLCQPGLAIDLDTTSLPIVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLNPPCARWSQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPSAGPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLCLWNDGCIVGFISKERERALLKDQQPGTFL
LRFSESCREGAITFTWVERPQNGGESCFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKFLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSQLQTT
DNLLPMSPEEFDEVSRIVGAVEFDMMNAV
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgtcccagtggtatgagcttcagcagcttgactccaaattcctggagcaggttcaccag
ctctatgatgacagttttcccatggaaatcagacagtatctggcacagtggctagaaaag
caagactgggaacatgccgccaatgatgtttcatttgctaccatccgttttcacgacctc
ctatcgcagctggatgatcaatacagtcgcttttctttggagaataattttttgttgcag
cataacataaggaaaagcaagcgtaatcttcaggataattttcaggaagacccaatacag
atgtctatgatcatctgtaactgtctgaaggaggaaagaaagatcctggaaaatgcccag
agattcaatcaggctcaggcagggaatattcagaatactgtaatgttagacaaacagaag
gagcttgacagcagagtcagaaatgtgaaggacaaagttatgtgtatagagcatgaaatc
aagaccttagaagatttacaggatgaatatgactttaaatgcaaaaccttgcagaacaga
gaacatgaaaccaatggtgtggcaaagaatgatcagaaacaggaacagatgttactccag
aagatgtatttaatgcttgacaataagagaaaggaagtagttcacaaaataatagagttg
ttgaatgccaccgaacttacccagaaagccctgattaatgatgaacttgtggaatggaag
cggagacagcagagtgcctgtatcgggggaccccccaatgcttgcctcgatcagctgcag
aactggttcaccatagtggcggagagtctgcagcaagttcgtcagcagcttaaaaagctt
gaggagttggaacagaaatacacctatgaacatgaccctatcacaaaaaacaaacaagcg
ttatcggaccgcaccttcagcctcttccagcagctcattcagagctcgtttgtggtggaa
agacagccctgcatgccaactcaccctcagaggccattggtcctgaagactggagtacaa
ttcactgtgaagttgagattgttggtgaaattgcaagagctgaattataacttgaaagtc
aaagtctcatttgataaagatgtgaatgagagaaatacagtaaaagggtttagaaagttc
aacattttgggcactcacacgaaggtgatgaacatggaggagtccaccaatggaagtctg
gcggcagaattccgacacctgcaactgaaagaacagaaaaacgccggtgccagaaccaac
gagggtcctctcatcgttactgaagagcttcactcccttagttttgaaacccagttgtgc
cagcctggtttggccattgaccttgacacgacctctctgcccatcgtggtgatctccaat
gtcagccagctcccgagtggttgggcctccatcctgtggtacaacatgctggtggcagaa
cccaggaatctgtccttcttcctgaacccaccttgtgcacgatggtctcagctttcagag
gtgctgagttggcagttttcttctgtcaccaaaagaggtctcaatgtggaccagctgaac
atgctgggagagaaacttcttggtcccagtgctggccctgatggtcttattccatggact
cgcttctgtaaggaaaatataaatgataaaaattttcctttctggctttggattgaaagc
atccttgaactcattaaaaaacacctgctctgtctctggaatgatgggtgtatcgtgggc
tttatcagcaaggagcgagagcgggctttgctgaaggaccagcagccggggacattcttg
ctgcggttcagtgagagctgccgggaaggggccatcacgttcacatgggtggagcggccc
cagaacggaggtgaatcttgcttccatgcggttgaaccctacacaaagaaagaactttct
gctgttactttccctgacattattcgcaattacaaagtcatggccgctgagaatattcca
gagaatcccttgaagtttctgtatccaaatattgataaagaccatgcctttggaaagtac
tactccaggccaaaggaagccccagagcctatggaacttgatggccctaaaggaacagga
tatatcaagactgaattgatttctgtgtctgaagttcacccttctcaacttcagaccaca
gacaaccttcttcccatgtctcctgaggagtttgacgaggtgtctcggatagtgggcgct
gtagaatttgacatgatgaatgcagtataa

DBGET integrated database retrieval system