KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103013788Help
Entry
103013788         CDS       T03086                                 

Gene name
WDHD1
Definition
(RefSeq) WD repeat and HMG-box DNA binding protein 1
  KO
K11274  chromosome transmission fidelity protein 4
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bacu03036]
    103013788 (WDHD1)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    103013788 (WDHD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mcl1_mid WD40 ANAPC4_WD40 eIF2A HMG_box
Motif
Other DBs
NCBI-GeneID: 103013788
NCBI-ProteinID: XP_007192950
UniProt: A0A384AZY3
LinkDB All DBs
Position
Un
AA seq 1131 aa AA seqDB search
MPATQKPMRYGHTEGHTDVCFDDSGSCIVTCGSDGDVRIWEDLDDDDPKSINVGEKAYSC
ALKNGKLVTAVSNNTVQVHTFPEGIPDGILTRFTTNANHVIFNGDGAKIAAGSSDFLVKV
VDVVDCSQQKTFRGHDAPVLSLSFDPKDIFLASASCDGSVKVWQISDQTCAISWPLLQKC
NDVVNAKSICRLAWQPKSGKLLAVPVEKSVKLYRRETWSNQFDLSDNFISQTLNIVTWSP
CGQYLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLSWHPTCGQIAYTDAEGNLGVL
ENVCDPSGKMSSSKVSSRVEKDYNDLFDGEDTSSAGDFLNDNAVETRSFSKGIINDEEDD
DDLMLASGRPRQRSHILEDDENSVDVTMIKTGSSFLKEEEEDDQAGSIHNLPVVTSQRPF
YDGPMPTPRQRPFQSGSTPLHLTHRFMVWNSIGIIRCYNDEQDNAIDVEFHDTSIHHATH
LSNTLNYTVADLSHEAVLLACESTDELASKLHCLHFSSWDSSKEWIVDMPQNENIEAICL
GQGWAAAATSALLLRLFTIGGVQKEVFSLPGPVVSVAGHGEQLVIVYHRGTGFDGDQCLG
VQLLELGKKKKQILHGDPLPLTRKSYLVWVGFSAEGTPFYVDSEGIVRMLNRGLGHTWTP
VCNTREHCKGKSDHYWVVGIHENPQQLRCIPCKGSRFPPTLPRPAVAVLSFKLPYCQTAT
EKGQMEEQYWRSVTFHNHLDYLAKNGYEYEESTKNQAIKEQQELLMKMLALSCKLEREFR
CVELADLMTQNAVNLAIKYASRSRRLILAQRLSELAVEKAAESAATQAEEEEEEEEDFRK
KLNAGYSNTPTEWSQPRLRNQVEEDSEDTGEADDIEEKPEIHKHGENPFFKSVNSSDMPA
IKSGAVTSSNQGRINPFKVSGNSKEPSISVNSVRSTNILDNMNKSSKKSTALNRATNYEK
SPVIKPLVPKPKSKQASAASFFQKRTSQADRTEEVKEENPKNPSPETPAMCPQNTENQRP
KTGFQMWLEENRCNILSDNPDFSDEADIIKEGMVRFRVLSTEERKAWAAKAKGGTASDGA
EEKKRKRVVEDSHETENQKERTKENLNLPKKQKPLDLSTNQKLSAFAFNQE
NT seq 3396 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctacacagaagccgatgagatatgggcacacagagggacacacagatgtctgt
tttgatgattctgggagttgtattgtaacttgtggaagtgatggtgatgtgaggatttgg
gaagacttggatgatgatgatcctaagtccattaatgttggagaaaaagcatattcatgt
gctttgaagaatgggaaattggtcactgcagtatctaacaatactgttcaagtgcacacg
tttcctgaaggaattccagatggtatattgactcgcttcaccacaaatgcaaaccatgtg
atctttaatggggatggtgcaaaaattgctgctggatctagtgattttctagtcaaagtt
gtggatgtggtggattgcagccaacagaaaacatttcgaggacacgatgcacctgtttta
agtctttcctttgaccctaaggacatctttctggcatcagctagttgtgatggatctgtc
aaggtgtggcaaatttcagatcagacatgtgctattagttggccactgctgcaaaaatgc
aatgatgtggtaaatgcaaaatcaatctgcagacttgcttggcagccaaaaagtgggaag
ttactagcagttcctgtggaaaaatctgttaagctatatagaagagaaacttggagtaat
caatttgatctttcagataatttcatctctcagaccctaaatatagtaacctggtctcct
tgtggacaatatttagctgcagggagtattaatggtttaattatagtttggaatgtggaa
accaaagattgcatggaaagggtgaaacatgagaaaggttatgcaatttgtggcctgtca
tggcatcctacttgtggtcaaatagcttatactgatgcagaaggaaatctaggagtcctg
gagaatgtttgtgaccccagtggaaagatgtcaagcagtaaggtatctagcagagtagaa
aaggattataacgatctttttgatggagaagatacaagtagtgccggtgattttctaaat
gacaatgcagtcgaaacccgctctttttcaaaagggattataaatgatgaggaagatgat
gatgacctcatgctggcttcaggtcgtcctagacagcgaagtcatatcctagaagatgat
gaaaactcagttgatgttacaatgataaaaactggttctagttttctcaaagaagaggag
gaagatgatcaggcaggcagcattcacaatctaccagttgtaacatcccaaaggccattt
tatgatggtcctatgccaacgccccggcaaaggccattccagtcaggttctacacccttg
catctcactcacagattcatggtgtggaactctattggaattattcgctgctataatgat
gagcaagacaatgccatagatgtggagttccatgatacctccatacaccatgcaacacac
ttatcaaacactttgaattacacagtagcagatctttcccatgaagctgttttgctggca
tgtgaaagcactgatgaactagcaagcaagcttcactgcctgcactttagttcatgggat
tcaagcaaagagtggatagtagacatgcctcagaatgaaaacattgaagccatatgtctt
ggtcagggatgggctgctgctgccactagcgccttgctccttcgcttgtttaccattgga
ggtgttcaaaaagaggtcttcagtctccctgggcctgttgtgtcagtggcaggacatgga
gaacagcttgtcattgtttatcacagaggtacaggatttgatggggatcagtgccttgga
gttcaactgctagagctggggaagaagaaaaaacaaattttacatggggatcctcttcct
cttacaaggaaatcctaccttgtgtgggttggcttttcagctgaaggtaccccattttat
gtggattcagaaggcattgttcgaatgcttaacagaggacttggtcatacgtggactcct
gtatgtaacaccagagaacactgcaaaggaaaatctgatcactactgggtggttggtatc
catgaaaatccccagcaactgaggtgtattccttgcaaaggttctcgatttcctcccacc
cttccacgccctgcggtagctgtattatcctttaagcttccttactgtcagactgccaca
gagaaaggacaaatggaggaacagtactggcgttcagttacgtttcacaaccaccttgat
tatttagctaaaaatggttatgaatatgaagagagcactaaaaatcaagcaataaaagaa
caacaggaacttttaatgaaaatgcttgcgctttcttgtaaactggagagggaatttcgt
tgtgtggaacttgctgatctaatgactcaaaatgctgtgaatttagccattaaatatgct
tctcgttctcggagattaatactggcccagagacttagtgaactggctgtagagaaagca
gcagaatcggcagccacccaagctgaagaagaggaagaagaagaagaggatttcagaaaa
aagttgaatgctggttacagtaatactcctacagagtggagtcagccaaggctcagaaat
caagttgaagaagattcagaggatactggagaagctgatgatatagaagaaaaaccagaa
atacacaaacatggagaaaacccatttttcaaaagtgtaaattcctctgatatgccagct
attaagtcaggtgcagttacctctagcaaccaaggacgaataaaccccttcaaggtatca
ggcaattccaaagagccatccatttcagtgaattcagtacgttcaactaatattttagac
aatatgaacaaatcatccaagaaatctactgcacttaatcgagctacaaattatgaaaag
tctccagttataaagcctctggttccaaaaccaaagtctaagcaggcatctgcagcatcc
tttttccagaaaagaacttcccaagctgataggactgaggaagtaaaagaagaaaatcct
aaaaatccatcacctgaaaccccagctatgtgtcctcaaaacactgaaaatcaaaggcca
aagaccgggttccagatgtggctggaagaaaacagatgtaatattttgtctgacaatcct
gacttttcagatgaagcagacataataaaagaaggaatggttcgatttagagtattgtca
actgaagaaaggaaggcatgggctgccaaggccaaaggaggaactgcaagtgatggagct
gaagaaaagaaacgaaaacgtgtggtcgaggatagtcacgaaactgaaaaccagaaagaa
agaacgaaggagaatctgaatttgcctaaaaagcaaaaacctttagatctttctacaaat
cagaaactgtcagcttttgcatttaatcaggaatag

DBGET integrated database retrieval system