KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103013794Help
Entry
103013794         CDS       T03086                                 

Definition
(RefSeq) peroxisomal multifunctional enzyme type 2-like
  KO
K12405  (3R)-3-hydroxyacyl-CoA dehydrogenase / 3a,7a,12a-trihydroxy-5b-cholest-24-enoyl-CoA hydratase / enoyl-CoA hydratase 2 [EC:1.1.1.- 4.2.1.107 4.2.1.119]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00120  Primary bile acid biosynthesis
bacu01040  Biosynthesis of unsaturated fatty acids
bacu01100  Metabolic pathways
bacu01212  Fatty acid metabolism
bacu04146  Peroxisome
Module
bacu_M00861  beta-Oxidation, peroxisome, VLCFA
bacu_M00862  beta-Oxidation, peroxisome, tri/dihydroxycholestanoyl-CoA => choloyl/chenodeoxycholoyl-CoA
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    103013794
   01040 Biosynthesis of unsaturated fatty acids
    103013794
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103013794
Enzymes [BR:bacu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     103013794
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.107  3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA hydratase
     103013794
    4.2.1.119  enoyl-CoA hydratase 2
     103013794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR
Motif
Other DBs
NCBI-GeneID: 103013794
NCBI-ProteinID: XP_007194118
LinkDB All DBs
Position
Un
AA seq 235 aa AA seqDB search
MKKQKFGRIIMTSSASGIYGNFGQANYCAAKLGLLGLSNCLAVEGEKSNIHCNTIAPTAG
SRLTQNILPDDLLEALKPDYVAPLVLWLCHESCEENGGLFEVGAGWIGKCKSLLVFGLPY
IISISLNLHIQVELGKDLVKCRTIGFSARIIKLKHCNSNRSSKTWKLSCRPVVFSRIFSV
FFLLAVLIQYLSCPIQNWLFFQTAQSLFILMCVFPCLRHPTCLFSRVVSGREGVF
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacagaaatttggaaggatcatcatgacttcatcggcttcaggaatatatggc
aactttggccaggcaaattattgtgctgcaaagctgggtcttctgggcctttcaaattgt
cttgcagttgaaggcgagaaaagcaacattcattgtaacactattgcccctactgctgga
tcacggttgacccagaacattttgcctgatgatcttctggaagctctgaagccagattac
gtggcacccctggtcctttggctttgccatgagagttgtgaggaaaatggtggcttgttt
gaggttggagcaggatggattggaaaatgtaagtctcttttggtttttggtttgccatac
attatttccatatctttaaacctgcatatccaggtagagctgggtaaagaccttgtcaaa
tgccgaaccattggatttagtgcacgcataatcaaactcaaacattgtaatagcaacagg
tcttctaaaacatggaagttgtcctgcaggcctgtggtattttcaaggatcttttcagtt
tttttcctattagcagtgcttattcaatatttgtcctgtcctattcagaactggctgttt
tttcagacagcacagtctctctttatattgatgtgtgtcttcccatgtctccggcacccc
acatgcttgttcagcagagtagtgagtggaagggagggtgttttttga

DBGET integrated database retrieval system