KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103013798Help
Entry
103013798         CDS       T03086                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00020  Citrate cycle (TCA cycle)
bacu00190  Oxidative phosphorylation
bacu01100  Metabolic pathways
bacu01200  Carbon metabolism
bacu04714  Thermogenesis
bacu04932  Non-alcoholic fatty liver disease (NAFLD)
bacu05010  Alzheimer disease
bacu05012  Parkinson disease
bacu05016  Huntington disease
Module
bacu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bacu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bacu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103013798 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103013798 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    103013798 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    103013798 (SDHB)
   05012 Parkinson disease
    103013798 (SDHB)
   05016 Huntington disease
    103013798 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103013798 (SDHB)
Enzymes [BR:bacu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103013798 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 103013798
NCBI-ProteinID: XP_007175068
UniProt: A0A383ZIU0
LinkDB All DBs
Position
Un
AA seq 280 aa AA seqDB search
MAAVVAVSLRRRFPATTLGRACLQACRGAQTAAATAPRIKKFAIYRWDPDKTGDKPHMQT
YEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKEQYLQSIEDREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTNTCPKGLNPGKAIAEIKKMMATYKEKKVSA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcgcagtctccttgaggcgccggttcccggccacaacccttggcaga
gcctgcctgcaggcctgccgtggggcccagacagctgcagccacagctccccgaatcaag
aaatttgccatctatcgatgggacccagacaagactggagataaacctcatatgcaaact
tacgaaattgatttgaataactgtggtcctatggtgttggatgctttaatcaagattaag
aatgaaattgattctaccttgaccttccgaagatcctgcagagaaggcatctgcggctcc
tgtgccatgaacatcaatggaggcaacactctcgcttgtacccgaaggattgacaccaac
ctcaacaaagtttcaaaaatctaccctcttccacatatgtatgtgataaaggatcttgtt
cctgatttgagcaacttctatgcccagtacaagtccattgagccttatttaaagaagaag
gatgaatcccaggaaggcaaggagcagtatctgcagtccatagaagatcgtgagaaactg
gacgggctctatgagtgcattctctgcgcctgctgcagtaccagctgcccgagctactgg
tggaatggagacaagtacttgggacctgcggttcttatgcaggcctatcgctggatgatc
gactccagagacgacttcacagaggagcgcctggccaagctgcaggacccgttctctctg
taccgctgccacaccatcatgaactgcacgaatacctgtcccaaggggctgaatccaggg
aaagctattgctgaaatcaagaaaatgatggcaacctataaggaaaagaaagtttcagct
taa

DBGET integrated database retrieval system