KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103014074
Entry
103014074         CDS       T03086                                 

Gene name
RASSF5
Definition
(RefSeq) Ras association domain family member 5
  KO
K08015  Ras association domain-containing protein 5
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04218  Cellular senescence
bacu04670  Leukocyte transendothelial migration
bacu05200  Pathways in cancer
bacu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103014074 (RASSF5)
   04015 Rap1 signaling pathway
    103014074 (RASSF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103014074 (RASSF5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    103014074 (RASSF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103014074 (RASSF5)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    103014074 (RASSF5)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2 PHD
Other DBs
NCBI-GeneID: 103014074
NCBI-ProteinID: XP_007195214
UniProt: A0A384B7G4
LinkDB
Position
Un
AA seq 421 aa
MAMASPAIGQRPYRLLLDPEPPRYLQSLSGPKPPPPPPPPPGRSSRRCAPAPLSTAPGAH
EGRGARRAARGDLEPQPRASRPARALRPGLQQRLRRRPGAPRPRDVRSIFEQPQDPRVPA
ERGEGHCFTELELRSGWGWCDLCGREVLRQALRCANCKFTCHPECRSLIQLDCSQQGGPS
RDRPSPESTLTSTFSQNDCKPAEEPRCPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYT
GFIKVHLKLRRPVTVPAGIRPPSIYDAIKEVDLAATTDKRTSFYLPLDAIKQLHISSTTT
VSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSVADCPLYLRLLAGPDTDVLSF
VLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEETLRESRGKP
A
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggccatggcgtccccggccatcgggcagcgcccgtaccggctactcttggacccagaa
ccgccgcgctatctacagagcctgagcggccccaagccgccgccgccgccaccgccgccc
ccgggccggtcctcgcgccgctgcgcccccgcgcccctctccactgcgcccggggcgcac
gagggacgcggtgccagaagggctgcccggggggacttggagccacagcctcgggcttcc
cgacccgctcgcgcgctccggcctggtctgcagcagagactgcggcggcggcctggagcg
ccccggccccgagacgtgcggagcatcttcgagcagccgcaggatccccgcgtcccggcg
gagcgaggcgaggggcactgcttcaccgaactggagctgcggagcggctggggctggtgt
gacctgtgcggacgagaggtgctgcgtcaggcgctgcgctgcgctaactgtaaattcacc
tgccacccggagtgccgcagcctgatccagctggactgcagtcagcagggaggcccctcc
cgggacagaccctctccagaaagcaccctcacttcgaccttcagccagaatgactgtaaa
cccgcagaggagccgcggtgcccgcccacgctgcaggagatcaagcagaagatcgacagc
tacaacacccgggaaaagaactgcctgggcatgaagctgagtgaagacggcacctacacg
ggtttcatcaaagtgcatttgaaacttcggcggccggtgacggtgcctgctgggatccgg
ccgccgtccatctatgacgccatcaaggaagtggacctggcagccaccacggacaagcgg
acatccttctacctgccgctggatgccatcaagcagctgcacatcagcagcaccaccacg
gtcagtgaggtcatccaggggctgctcaagaagttcatggtcgtggacaacccccagaag
tttgcactttttaagcggatacacaaggacgggcaagtgctcttccagaaactctccgtt
gctgactgccccctttacctgcgcttactcgctgggcctgacacggatgtgctcagcttc
gtgctaaaggagaacgaaactggagaggtggagtgggatgccttctccatccccgagctc
cagaacttcctaacaatcctggaaaaagaggagcaggacaaaatccaacaagtgcagaag
aagtatgacaagtttaggcagaaactggaggagaccttaagagaatccaggggcaaacct
gcctag

DBGET integrated database retrieval system