KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103014148
Entry
103014148         CDS       T03086                                 

Gene name
FADD
Definition
(RefSeq) Fas associated via death domain
  KO
K02373  FAS-associated death domain protein
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01524  Platinum drug resistance
bacu04210  Apoptosis
bacu04215  Apoptosis - multiple species
bacu04217  Necroptosis
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04622  RIG-I-like receptor signaling pathway
bacu04657  IL-17 signaling pathway
bacu04668  TNF signaling pathway
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05132  Salmonella infection
bacu05142  Chagas disease
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103014148 (FADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103014148 (FADD)
   04215 Apoptosis - multiple species
    103014148 (FADD)
   04217 Necroptosis
    103014148 (FADD)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103014148 (FADD)
   04621 NOD-like receptor signaling pathway
    103014148 (FADD)
   04622 RIG-I-like receptor signaling pathway
    103014148 (FADD)
   04657 IL-17 signaling pathway
    103014148 (FADD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103014148 (FADD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103014148 (FADD)
   05022 Pathways of neurodegeneration - multiple diseases
    103014148 (FADD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103014148 (FADD)
   05152 Tuberculosis
    103014148 (FADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103014148 (FADD)
   05161 Hepatitis B
    103014148 (FADD)
   05160 Hepatitis C
    103014148 (FADD)
   05164 Influenza A
    103014148 (FADD)
   05162 Measles
    103014148 (FADD)
   05168 Herpes simplex virus 1 infection
    103014148 (FADD)
   05163 Human cytomegalovirus infection
    103014148 (FADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103014148 (FADD)
   05169 Epstein-Barr virus infection
    103014148 (FADD)
   05165 Human papillomavirus infection
    103014148 (FADD)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103014148 (FADD)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103014148 (FADD)
SSDB
Motif
Pfam: DED Death ZapA tRNA_NucTran2_2
Other DBs
NCBI-GeneID: 103014148
NCBI-ProteinID: XP_007171188
UniProt: A0A383Z7J3
LinkDB
Position
Un
AA seq 210 aa
MAPFLVLLHSVSAGLSSSELTELKFLCQSRVGKRKLERVQSGLDLFSVLLEQNEMSPENT
VLLREMLVSLRRQDLLRRLEDFEAGAAGGAAPEERDLRAAFDIICDNVGKDWRKLARHLR
VSDAKIEAIEEKYPRNLAEQVRESLRVWKNSRREDAAASHLVRALRACRLNLVADLIEEG
QRARALQSESGDPVSLSSWDSDSPASGASR
NT seq 633 nt   +upstreamnt  +downstreamnt
atggccccgttcctggtgctgctgcactcggtgtcggccggcctgtcgagcagcgagctg
accgagctcaagttcctgtgtcagagccgcgtgggcaagaggaagctggagcgcgtgcag
agtggcctggacctcttctccgtgctgctggagcagaacgagatgagccccgagaacacc
gtgctgctccgcgagatgctcgtctccctgcggcgccaggacctactgcggcgcctggaa
gacttcgaggcgggcgcggcgggcggggccgcgccggaggagcgagacctgcgggcagcg
tttgacatcatctgtgataatgtggggaaggactggaggaaactggctcgtcacctcaga
gtgtctgacgccaagattgaagccattgaggagaagtatccccggaacctggcagaacag
gtgagggagtcgctgagagtctggaagaacagcaggagggaggatgcggccgcgtcccac
ctggtgagggcgctcagggcctgccggctgaacctggtggcagacctcatcgaggagggt
cagcgggcccgggccctccagagcgagagtggggaccctgtgtccctctcgtcctgggac
tcagactcgcccgcctcaggggcctcgcgatga

DBGET integrated database retrieval system