KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103014625
Entry
103014625         CDS       T03086                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04022  cGMP-PKG signaling pathway
bacu04141  Protein processing in endoplasmic reticulum
bacu04151  PI3K-Akt signaling pathway
bacu04211  Longevity regulating pathway
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04668  TNF signaling pathway
bacu04728  Dopaminergic synapse
bacu04911  Insulin secretion
bacu04915  Estrogen signaling pathway
bacu04918  Thyroid hormone synthesis
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu05020  Prion disease
bacu05030  Cocaine addiction
bacu05031  Amphetamine addiction
bacu05034  Alcoholism
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103014625 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103014625 (ATF6B)
   04022 cGMP-PKG signaling pathway
    103014625 (ATF6B)
   04151 PI3K-Akt signaling pathway
    103014625 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103014625 (ATF6B)
   04915 Estrogen signaling pathway
    103014625 (ATF6B)
   04926 Relaxin signaling pathway
    103014625 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    103014625 (ATF6B)
   04918 Thyroid hormone synthesis
    103014625 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    103014625 (ATF6B)
   04925 Aldosterone synthesis and secretion
    103014625 (ATF6B)
   04927 Cortisol synthesis and secretion
    103014625 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103014625 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    103014625 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    103014625 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103014625 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    103014625 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    103014625 (ATF6B)
   05031 Amphetamine addiction
    103014625 (ATF6B)
   05034 Alcoholism
    103014625 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103014625 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103014625 (ATF6B)
   05161 Hepatitis B
    103014625 (ATF6B)
   05163 Human cytomegalovirus infection
    103014625 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103014625 (ATF6B)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103014625 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 103014625
NCBI-ProteinID: XP_007193978
UniProt: A0A384B353
LinkDB
Position
Un
AA seq 714 aa
MVGGRGGKMAELMLLSEIADPTRFFTDNLLSPEDWDSTLYAGLDEAAEEQTQLFLCPEQD
VPFGSSSLDLGMDVSPPEPPWDSLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPSSQA
SGVGEVLVVKSESLTPSLCLLGDDPTSPFETVQINVGPTSDDPSDVQIKIEPVSPSSSIN
SEASLLSAESPSQAFIGEEVLEVKTESPSPQGCLLRDVSGPPLGAVQISMGLSSDGSSGK
PLPARKPPLQPKPVLITTVPMPPRAVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQPEGL
TPPAPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEA
RLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVS
ISEPPPAPISPRMSREEPRPQRHLLEFSAQEPVHGVEHPQHPSHGPKETQPSSTGPPSFR
NLTAFPGGTKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRPQ
ERQKSQLWKKSPPVKAVPTQPPGPPERDSVGQLQLYRQPDRSQPEFLDAIDRREDTFYVV
SFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGPPGDYEEMMQIECEVMDTRVI
HIKTSTVPPSLRKQPSSTPGNATGGPLPASAASQAHQAARQPSTSIIPDLYDSH
NT seq 2145 nt   +upstreamnt  +downstreamnt
atggttggggggcgggggggaaagatggcggagctgatgctcctcagcgagattgcggac
ccgacgcgctttttcaccgacaatttgctgagcccggaggactgggacagcaccttatac
gccggcctggatgaagcggccgaggagcaaacgcagctcttcctttgcccggagcaggat
gtcccgtttggcagcagttccctggacttggggatggatgtcagccctcctgaacccccc
tgggactctctgcctatcttcccagatcttcaggtgaagtctgagccatcctccccctgc
tcttcctcctccctcagctctgaatcgtcgcacctttctacagagccctccagccaggcc
tctggtgtaggggaggtgctggtcgtgaagtcagagtccttgacaccctcactctgcctc
ctgggagatgatccaacatccccatttgaaaccgtccagatcaatgtgggccccacctct
gatgatccctcagatgtccagattaagatagaacctgtctctccatcttcctccatcaac
tcggaggcttccctgctctctgcggagtcccccagccaggcttttataggagaggaggta
ctggaagtgaagacagagtccccatcccctcaagggtgtctcttgcgggatgtctcaggc
cccccacttggagctgtgcagatcagcatgggcctgtcctctgatggctcctcaggcaaa
cccctgcccgcccggaagccaccactgcagcccaaacctgtgttgataaccactgtcccg
atgccaccgagagccgtgcctcccagcaccactgtccttttgcagccccttgtccagcca
cccccagtgtccccagttgttctcatccaaggtgctattcgagtccagcctgagggactg
accccccctgctccacggcctgagaggaagagcattgttccagctcctatgcctgggaac
tcctgcccgcctgaggtggatgcaaagctgctgaagcggcagcagcgaatgatcaagaac
cgggagtcggcctgccagtcccggaggaagaagaaagagtatctgcaggggctggaagct
cggctgcaggcggtgctggctgacaaccagcagctccggcgggagaatgctgccctccgc
cggcggctggaggccctgctggctgagaacagcgagctcaagttagggtctggaaacagg
aaggtggtctgcatcatggtcttccttctcttcattgccttcaacttcgggcctgtcagc
atcagtgagcctcctccagctcccatctctcctcggatgagcagagaggagcctcgaccc
cagagacacttgctggagttctcggcgcaagagccagttcacggagtcgagcacccccag
catccctcccacggtcccaaggagacccagcccagctccacgggccccccaagtttcagg
aacctgacagccttccctgggggcaccaaggagctgctgctgagagacctggaccagctc
ttcctctcctctgattgccggcacttcaaccgaaccgagtccctgaggcttgctgatgag
ctgagtggctgggtccagcgccaccagagaggccggcggaagatcccccagaggccccag
gagagacagaagtctcagctatggaagaagtcgcctccagttaaggcagtccccacccaa
ccccctgggcccccggaaagggattctgtgggccagctgcagctatatcgccaaccagac
cgttcgcagccggagttcctggatgcaattgaccgacgggaagacacattttatgttgtc
tccttccgaagggaccacttgctgctcccagccatcagccacaacaagacctctcggccc
aagatgtccctggtgatgcccgccatggcccccaatgagaccctgtcaggccgggggccc
ccgggggactatgaggagatgatgcagatcgagtgtgaggtcatggacaccagggtgatt
cacatcaagacctccacagtgcccccctcgctccgaaaacagccgtcctcaaccccgggc
aatgccacaggtggccccttgccagcttctgcagccagccaggcccaccaggccgcccgt
cagccctctacctcaatcatccctgacctctacgactcacactga

DBGET integrated database retrieval system