KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103014764
Entry
103014764         CDS       T03086                                 

Gene name
PLCG2
Definition
(RefSeq) phospholipase C gamma 2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00562  Inositol phosphate metabolism
bacu01100  Metabolic pathways
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04020  Calcium signaling pathway
bacu04062  Chemokine signaling pathway
bacu04064  NF-kappa B signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04070  Phosphatidylinositol signaling system
bacu04072  Phospholipase D signaling pathway
bacu04360  Axon guidance
bacu04370  VEGF signaling pathway
bacu04380  Osteoclast differentiation
bacu04611  Platelet activation
bacu04613  Neutrophil extracellular trap formation
bacu04625  C-type lectin receptor signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04670  Leukocyte transendothelial migration
bacu04722  Neurotrophin signaling pathway
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04919  Thyroid hormone signaling pathway
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04935  Growth hormone synthesis, secretion and action
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05214  Glioma
bacu05223  Non-small cell lung cancer
bacu05225  Hepatocellular carcinoma
Module
bacu_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103014764 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103014764 (PLCG2)
   04014 Ras signaling pathway
    103014764 (PLCG2)
   04370 VEGF signaling pathway
    103014764 (PLCG2)
   04064 NF-kappa B signaling pathway
    103014764 (PLCG2)
   04066 HIF-1 signaling pathway
    103014764 (PLCG2)
   04020 Calcium signaling pathway
    103014764 (PLCG2)
   04070 Phosphatidylinositol signaling system
    103014764 (PLCG2)
   04072 Phospholipase D signaling pathway
    103014764 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103014764 (PLCG2)
   04613 Neutrophil extracellular trap formation
    103014764 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    103014764 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    103014764 (PLCG2)
   04662 B cell receptor signaling pathway
    103014764 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    103014764 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    103014764 (PLCG2)
   04670 Leukocyte transendothelial migration
    103014764 (PLCG2)
   04062 Chemokine signaling pathway
    103014764 (PLCG2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    103014764 (PLCG2)
   04919 Thyroid hormone signaling pathway
    103014764 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103014764 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103014764 (PLCG2)
  09158 Development and regeneration
   04360 Axon guidance
    103014764 (PLCG2)
   04380 Osteoclast differentiation
    103014764 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103014764 (PLCG2)
   05206 MicroRNAs in cancer
    103014764 (PLCG2)
   05205 Proteoglycans in cancer
    103014764 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103014764 (PLCG2)
   05214 Glioma
    103014764 (PLCG2)
   05223 Non-small cell lung cancer
    103014764 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103014764 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103014764 (PLCG2)
   05171 Coronavirus disease - COVID-19
    103014764 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103014764 (PLCG2)
   05169 Epstein-Barr virus infection
    103014764 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103014764 (PLCG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103014764 (PLCG2)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     103014764 (PLCG2)
Membrane trafficking [BR:bacu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103014764 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    103014764 (PLCG2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH SH3_2 PH_12 PH_14 EF-hand_like
Other DBs
NCBI-GeneID: 103014764
NCBI-ProteinID: XP_007182651
UniProt: A0A384A5L0
LinkDB
Position
Un
AA seq 1265 aa
MSTAVNVDALPEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETQQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEECCFTILYGTQFVLSTLSLAADSKEDAT
KWLSGLKILHQEVMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLVNFKVSSA
KFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKLILDEFKKDSSVFILGNTDRPDASA
VHLHDFQRFLLHEQQELWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDVVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCCVEQQRHMARV
FREALGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTVEDEQPRDIAPTELHFGEKWFHKKVEKR
TSAEKLLQEYCAETGGKDGTFLVRESETYPNDYTLSFWRSGRVQHCRIRSTVEGGTLKYY
LTDNLMFTSIYALIQHYSETHLRCAEFELRLTDPVPNPSPHESKPWYYDGLSRGEAEDML
MRVPRDGAFLIRKREGTDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
EKHALYRKMKLRYPVTPELLERYNMERDVNSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKQSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTADGEELEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKPFVFILEPKKQGDPPVEFATDKVEELFEWF
QSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSVVRQKPNDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDKY
LQMNHALFSLNGRTGYVLQPESMRAEKYDPMPPESQRKILMTLTVKVLGARHLPKPGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPVWAPTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATFPIKGIKSGFRSVPLKNGYSEDIELACLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRSANRDALVREFNVNENQLQLYQEKCNRRLREKRVSN
SKFYS
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgagcaccgcggtcaacgtggacgcccttccggagtacgagaagagtcagatcaagagg
gccctggagctgggcacggtgatgacggtgttcagcttccgtaagtccaccccagagcgg
aggactgtccaggtgatcatggagacccagcaggtggcctggagcaagacggccgataag
atcgagggcttcctggatatcatggaaataaaggaaatccgcccagggaagaactccaag
gattttgagcgtgcgaaagcagtccgccagaaggaagagtgctgcttcaccatcttgtac
ggcacccagtttgtcctcagcacactcagcttggcagccgactctaaagaagatgcaact
aagtggctctctggcttgaagatcttacaccaggaagtgatgagcgcatccacccccacc
atcattgagagttggttgagaaagcagatttattctgtggatcaaaccagaagaaacagc
atcagcctccgagagttgaagaccatcttgcccctggtcaacttcaaagtgagcagcgcc
aagttcctcaaagataagttcgtggaaataggcgcacacaaagatgaactcagctttgaa
cagttccatctcttctataaaaaacttatgtttgaacagcaaaaattgattcttgacgaa
ttcaaaaaggattcctccgtgttcatcttgggcaacaccgaccggccggatgcctccgct
gttcacctgcacgacttccagcggttcctcttacatgaacagcaggagctttgggctcag
gatctgaacaaagtccgtgagcggatgacaaagttcattgatgacacgatgagagaaact
gccgagcccttcctgtttgtggatgagttcctcacgtacctgttttcccgggagaacagc
atttgggacgagaagtatgacgtggtggatatgcaggacatgaacaaccccttgtctcat
tactggatctcctcatcacataacacgtacctcacgggtgaccagcttcggagcgagtcg
tccccggaggcctatatccgctgtctgcggatgggctgccgctgcattgagctggactgc
tgggacgggcccgacgggaagcccatcatctaccacggctggacgcggaccactaagatc
aagtttgatgacgtcgtgcaggccatcaaagaccacgcctttgtcacctcgagcttcccc
gtgatcctgtccatcgaggagcactgctgtgtggagcagcagcgccacatggcccgggtg
ttccgggaggcgctcggcgacctgctgctcaccaagcccacggaggccagtgccgaccag
ctgccgtcgcccagccagctgcgggagaagatcatcatcaagcataagaagctgggcccc
cgaggcgacgtggatgtcaacatggaggacaagaaagatgaacacaagcagcagggggaa
ctgtacatgtgggattccatcgaccagaaatggactcggcactactgtgccattgctgat
gccaagctgtccttcagcgatgacattgaacagactgtggaagatgaacagccccgggat
atagcccccacggagctgcattttggggagaagtggttccacaagaaggtggagaagagg
acaagtgccgagaagctgctgcaggaatactgcgccgagacggggggcaaggatgggacc
ttcttggtgcgggagagcgagacctaccccaatgactacaccctgtccttctggcggtcg
ggccgcgtccagcactgccggatccgctccaccgtggagggcgggaccctgaagtattac
ctgactgacaacctcatgttcaccagcatctacgccctcatccagcactacagcgagacg
cacctgcgctgtgccgagttcgagctccggctcaccgacccagtccccaaccccagcccg
cacgagtcgaagccgtggtactatgatgggctgagccgtggagaagcggaggacatgctg
atgagggttccccgggatggggccttcctgatccggaagcgcgaaggtaccgactcctac
gccatcaccttcagggccaggggcaaggtgaagcactgtcgcatcaaccgggacggccgg
cacttcgtgctgggcacctccgcctacttcgagagcctcgtggagctggtcagctactac
gagaagcacgccctctaccggaagatgaaactgcgctaccccgtgacccccgagctcctg
gagcgctacaatatggaaagagatgtaaactccctctatgacgtcagcaggatgtatgtg
gatcccagtgaaatcaatccttccatgcctcagagaaccgtgaaagctctgtatgactac
aaagccaagcaaagcgatgagctgagcttctgccgtggcgccctcatccacaatgtctcc
aaggagcctgggggctggtggaaaggagactacggaaccagaatccagcagtacttcccg
tccaattacgttgaagacatttcaacagctgatggggaggagctggaaaagcagattatt
gaagacaatcccttagggtctctttgcagaggaatactggatctcaacacctataatgtt
gtaaaagccccacaggggaagaaccagaagcctttcgtctttatcttggagcccaagaag
cagggcgaccctcccgtggagtttgccacagacaaggtggaggaactgtttgagtggttc
cagagcatccgcgagatcacctggaagatcgacaccaaggagaacaacatgaagtactgg
gagaagaaccagtccatcgccatcgagctctcggacctcgtcgtctactgcaaaccaacc
agcaagaccaaggacaacctagaaaaccccgacttccgagaaatccgctccttcgtggag
acaaaggctgacagcgtcgtccgacagaaacccaacgatctcttgaaatacaatcaaaag
ggcctgacccgcgtttaccccaagggacagcgggtggactcgtccaactacgaccccttc
cgcctctggctgtgtggctcccagatggtggcgctcaatttccagactccagataagtac
ctgcagatgaatcacgccctgttttccctcaatgggcggactggctacgtcctgcagccc
gagagcatgagggcggagaagtacgaccccatgccgcccgagtcccagaggaagatcctg
atgactctgacggtcaaggttctgggggctcgtcatctccccaaacctggacgaagtatt
gcatgtccctttgtggaggtggaaatatgcggagccgaatatgacaacaacaagttcaaa
acaacagttgtgaatgacaacggcctaagccctgtttgggctccaacacaggagaaggtg
acgtttgaaatttatgacccaaacctcgcgtttctacgctttgtggtttacgaggaagat
atgttcagcgatcccaactttctcgcgcatgccactttccccattaaaggaatcaaatca
ggatttagatctgttcctctgaagaacggctacagtgaggacattgagctggcttgcctc
ctggtcttctgtgagatgcggccagtcctggagagcgaagaggagctttactcctcctgc
cgccagctgcggaggcggcaggaagaactgaacaaccagctctttctgtacgacacacac
cagaacttgcgcagcgccaaccgggatgccctggtcagagagttcaacgtcaacgagaac
cagctgcagctgtaccaggagaagtgcaaccgcaggttaagagagaagagagtcagcaac
agcaagttttactcatag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103016663
Entry
103016663         CDS       T03086                                 

Gene name
PLCG1
Definition
(RefSeq) phospholipase C gamma 1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00562  Inositol phosphate metabolism
bacu01100  Metabolic pathways
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04062  Chemokine signaling pathway
bacu04064  NF-kappa B signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04070  Phosphatidylinositol signaling system
bacu04072  Phospholipase D signaling pathway
bacu04360  Axon guidance
bacu04370  VEGF signaling pathway
bacu04613  Neutrophil extracellular trap formation
bacu04650  Natural killer cell mediated cytotoxicity
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04670  Leukocyte transendothelial migration
bacu04722  Neurotrophin signaling pathway
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04919  Thyroid hormone signaling pathway
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04935  Growth hormone synthesis, secretion and action
bacu05012  Parkinson disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05135  Yersinia infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05214  Glioma
bacu05223  Non-small cell lung cancer
bacu05225  Hepatocellular carcinoma
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
bacu_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103016663 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103016663 (PLCG1)
   04014 Ras signaling pathway
    103016663 (PLCG1)
   04015 Rap1 signaling pathway
    103016663 (PLCG1)
   04370 VEGF signaling pathway
    103016663 (PLCG1)
   04064 NF-kappa B signaling pathway
    103016663 (PLCG1)
   04066 HIF-1 signaling pathway
    103016663 (PLCG1)
   04020 Calcium signaling pathway
    103016663 (PLCG1)
   04070 Phosphatidylinositol signaling system
    103016663 (PLCG1)
   04072 Phospholipase D signaling pathway
    103016663 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103016663 (PLCG1)
   04650 Natural killer cell mediated cytotoxicity
    103016663 (PLCG1)
   04660 T cell receptor signaling pathway
    103016663 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    103016663 (PLCG1)
   04659 Th17 cell differentiation
    103016663 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    103016663 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    103016663 (PLCG1)
   04670 Leukocyte transendothelial migration
    103016663 (PLCG1)
   04062 Chemokine signaling pathway
    103016663 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    103016663 (PLCG1)
   04919 Thyroid hormone signaling pathway
    103016663 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103016663 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103016663 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    103016663 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103016663 (PLCG1)
   05206 MicroRNAs in cancer
    103016663 (PLCG1)
   05205 Proteoglycans in cancer
    103016663 (PLCG1)
   05231 Choline metabolism in cancer
    103016663 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103016663 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103016663 (PLCG1)
   05214 Glioma
    103016663 (PLCG1)
   05223 Non-small cell lung cancer
    103016663 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103016663 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    103016663 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103016663 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103016663 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103016663 (PLCG1)
   05171 Coronavirus disease - COVID-19
    103016663 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103016663 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103016663 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103016663 (PLCG1)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     103016663 (PLCG1)
Membrane trafficking [BR:bacu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103016663 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    103016663 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 PH SH3_9 SH3_2 PH_12 GDPD PH_9
Other DBs
NCBI-GeneID: 103016663
NCBI-ProteinID: XP_007193178
UniProt: A0A384B0S9
LinkDB
Position
Un
AA seq 1257 aa
MTLFYSKKSQRPERKTFQVKLETRQITWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQ
EDPAFRPDQSHCFVILYGMEFRLKTLSLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIE
RWLRKQFYSVDRNREDRISAKDLKNMLSQVNYRVPNMRFLRERLTDLEQRTSDITYGQFA
QLYRSLMYSAQKTMDLPFLEASALRAGERPELCRVSLPEFQQFLLEYQGELWAVDRLQVQ
EFMLSFLRDPLREIEEPYFFLDEFVTFLFSKENSIWNSQLDAVCPDTMNNPLSHYWISSS
HNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVL
HTIKEHAFVASEYPVILSIEDHCSIAQQRNMAQYFKKVLGDTLLTKPVDIAADGLPSPSQ
LKRKILIKHKKLAEGSAYEEVPTSVMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTS
SKIYYSEETSSDQGNEDEEEPKEASGSTELHSNEKWFHGKLGAGRDGRHIAERLLTEYCI
ETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYD
LITHYQQVPLRCNEFEMRLSEPVPQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVR
KRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLVSYYEKHPLYRKMKLRY
PINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPTFKCAVKALFDYKAQREDELTFTK
SAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEEMVSPAALEPEREHLDENSPLGDLLRG
VLDVPACQIAIRPEGKNNRLFVFSISMASVAHWSLDVAADSQEELQDWVKKIREVAQTAD
ARLTEGKMMERRKKIALELSELVVYCRPVPFDEEKIGTERACYRDMSSFPETKAEKYVNK
AKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQMNQALF
LAGGHCGYVLQPSIMRDEAFDPFDKSSLRGLEPCAICIEVLGARHLPKNGRGIVCPFVEI
EVAGAEYDSTKQKTEFVVDNGLNPMWPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLA
QATFPVKGLKTGYRAVPLKNNYSEDLELASLLVKVDVFPAKQENGDLSPFGGASLRERGC
DTSGQLFHGRAREGSFEARYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3774 nt   +upstreamnt  +downstreamnt
atgactttgttctactccaagaagtcgcagcggcccgagcggaagaccttccaggtcaag
ctggagacgcggcagatcacgtggagccgtggcgccgacaagatcgagggggccattgac
attcgagaaatcaaggagatccgcccggggaagacctcacgggacttcgatcgctaccaa
gaggatcctgcttttcgaccggaccagtcgcactgctttgtcatcctgtatggaatggaa
ttccgcctgaagaccctgagcctacaagctacgtctgaggacgaagtgaacatgtggatc
aagggcctgacttggctgatggaggatacattgcaggcggccacacccttgcagattgag
aggtggctgcggaagcagttctactcagtggaccggaatcgtgaggatcgtatatcagcc
aaggacctgaagaacatgctgtcccaggtcaactaccgggtccccaacatgcgcttcctc
cgagagcggctgacggacctggagcagcgcaccagcgacatcacctacgggcagtttgct
cagctgtaccgcagcctcatgtacagcgcccagaagacgatggacctccccttcctggaa
gccagtgccctgagggcgggggagcggccggagctctgccgggtgtcccttcctgagttc
cagcagttccttctcgagtaccagggggagctgtgggctgtcgaccggctccaggtgcag
gagttcatgctcagcttcctccgagaccccttgcgagagatcgaggagccttacttcttc
ctggatgagtttgtcaccttcctgttctccaaggagaacagcatatggaactcgcagctg
gacgccgtgtgcccggacaccatgaacaaccccctgtcccactactggatctcttcctcg
cacaacacgtacctgaccggggaccagttttccagcgagtcctccctggaagcctacgcc
cgctgcctgcggatgggctgccgctgcatcgagttggactgctgggacggtccagacggg
atgccagtcatttaccacggacacaccctgaccaccaagatcaagttctcagacgtcctg
cacaccatcaaggagcatgcctttgtggcctcagagtacccggtcatcttgtccatcgag
gaccactgcagcatcgcccagcagaggaacatggctcagtacttcaagaaagtgctcggg
gacacgcttctcaccaagcccgtggacattgctgctgatgggctcccctcacccagccag
ctcaagaggaagatcctcatcaagcacaagaagctggctgagggcagtgcctatgaagag
gtgcctacgtccgtgatgtactctgagaacgacatcagcaactccatcaagaacggcatc
ctctacctggaggaccccgtgaatcatgagtggtatccccactacttcgttctgaccagt
agcaagatctactactccgaggagaccagcagtgaccagggcaacgaggacgaggaggag
cccaaggaggccagtggcagcacagagctgcactccaatgagaagtggtttcacgggaag
ctcggggcgggacgggacgggcggcacatcgccgagcgcctgctcacggagtactgcatc
gagaccggggcccccgacggctccttcctcgtgcgcgagagcgagaccttcgtgggcgac
tacaccctctccttctggcggaacggcaaagtccagcactgccggatccactcccggcag
gacgcagggacccccaagttcttcctgacagacaacctcgtcttcgactcactctatgac
ctcatcacacactaccagcaggtgcccctgcgctgcaacgaatttgagatgcgcctctca
gaacccgtcccgcagaccaacgcccacgagagcaaagagtggtaccacgcgagcctgacc
agagcgcaggccgagcacatgctgatgcgtgtcccccgggacggggccttcctggtgcgg
aaacggaatgagcccaactcatacgccatctccttccgggctgagggcaagatcaagcac
tgccgtgtccagcaggagggccagaccgtgatgctgggcaactcagagtttgacagcctc
gtggacctcgtcagttactacgagaagcaccccctgtaccgcaagatgaagctacgctat
cccatcaacgaggaggcgctggagaagatcggcacagcggagcccgactacggggccctg
tatgaaggccgcaaccccggcttctacgtggaggcgaaccccatgccgactttcaagtgc
gccgtcaaagctctcttcgactacaaggcccagagagaggacgagctgactttcaccaag
agcgccattatccagaacgtggagaagcaggaaggaggctggtggcgtggtgactatggt
gggaagaagcagctgtggttcccgtcaaactacgtggaggagatggtcagccctgcggcc
ctggagcctgagagggagcacttggacgagaacagccccctgggggacttgctgcggggg
gtcttggatgtgccggcttgtcagatagccatccgtcctgagggcaagaacaatcggctc
ttcgtcttctccatcagcatggcatcggtggcacactggtccctagatgtggctgccgac
tcacaggaggagctgcaggactgggtgaagaagatcagggaggtggcccagacagccgat
gccaggctcactgaggggaagatgatggagcggaggaagaagatcgccctggagctctcc
gagcttgtcgtctactgccggcctgttcccttcgacgaagagaagatcggcacagaacgc
gcctgctaccgggacatgtcgtccttcccggaaaccaaggctgagaagtacgtgaacaag
gccaaaggcaagaagttcctccagtacaaccggctgcagctctcccgcatctaccccaag
ggccagcggctggactcctccaattacgaccccttgcccatgtggatctgtggcagtcag
ctggtggccctcaacttccagaccccagacaagcctatgcagatgaaccaggccctcttc
ctggccggcgggcactgtggctacgtgctgcagccgagcatcatgcgcgacgaggccttc
gacccctttgacaagagcagcctccgcgggctggagccatgtgccatctgcatcgaggtg
ctgggggcccggcatctgccgaagaatggccgaggcatcgtgtgtcctttcgtggagatt
gaggtggccggtgctgagtatgacagcaccaagcagaagacggagtttgtggtggacaat
ggactgaaccccatgtggccagccaagcccttccacttccagatcagtaaccccgaattc
gccttcctgcgctttgtggtgtatgaggaagacatgtttagtgaccagaacttcctagct
caggctaccttcccggtgaagggtctgaagacaggatacagagcggtgcctctgaagaac
aactatagcgaggacctggagttggcctccctgctcgtcaaggtcgacgttttccctgcc
aagcaggagaacggcgacctcagtccctttgggggtgcgtccctgcgggagcggggctgc
gacacctcgggccagctgtttcacggccgggcccgggaaggctccttcgaagctcgctac
cagcagccatttgaggacttccgcatctcccaggagcatctcgccgaccattttgacagt
cgggaacgaagggccccgcgaaggactcgggtcaatggagacaaccgcctctag

DBGET integrated database retrieval system