KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103014780
Entry
103014780         CDS       T03086                                 

Gene name
IGF1
Definition
(RefSeq) insulin like growth factor 1
  KO
K05459  insulin-like growth factor 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04114  Oocyte meiosis
bacu04115  p53 signaling pathway
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04510  Focal adhesion
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04730  Long-term depression
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04913  Ovarian steroidogenesis
bacu04914  Progesterone-mediated oocyte maturation
bacu04935  Growth hormone synthesis, secretion and action
bacu04960  Aldosterone-regulated sodium reabsorption
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05205  Proteoglycans in cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05218  Melanoma
bacu05224  Breast cancer
bacu05410  Hypertrophic cardiomyopathy
bacu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103014780 (IGF1)
   04014 Ras signaling pathway
    103014780 (IGF1)
   04015 Rap1 signaling pathway
    103014780 (IGF1)
   04066 HIF-1 signaling pathway
    103014780 (IGF1)
   04068 FoxO signaling pathway
    103014780 (IGF1)
   04151 PI3K-Akt signaling pathway
    103014780 (IGF1)
   04152 AMPK signaling pathway
    103014780 (IGF1)
   04150 mTOR signaling pathway
    103014780 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103014780 (IGF1)
   04115 p53 signaling pathway
    103014780 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103014780 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103014780 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    103014780 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    103014780 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    103014780 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103014780 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    103014780 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103014780 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    103014780 (IGF1)
   04213 Longevity regulating pathway - multiple species
    103014780 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103014780 (IGF1)
   05202 Transcriptional misregulation in cancer
    103014780 (IGF1)
   05205 Proteoglycans in cancer
    103014780 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    103014780 (IGF1)
   05218 Melanoma
    103014780 (IGF1)
   05215 Prostate cancer
    103014780 (IGF1)
   05224 Breast cancer
    103014780 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103014780 (IGF1)
   05414 Dilated cardiomyopathy
    103014780 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103014780 (IGF1)
   01522 Endocrine resistance
    103014780 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103014780 (IGF1)
Cytokines and growth factors [BR:bacu04052]
 Growth factors
  Growth factors (RTK binding)
   103014780 (IGF1)
SSDB
Motif
Pfam: Insulin DUF2865
Other DBs
NCBI-GeneID: 103014780
NCBI-ProteinID: XP_007165842
UniProt: A0A383YSK5
LinkDB
Position
Un
AA seq 187 aa
MGKISSLPTQLFKCCFCDFLKVKMHITPSSHLFYLALFLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKAQKYQPPSTNKKTKSQRRRKGGPKKHPGGEQKEGTEASQQMKGKKKEQR
RETGARN
NT seq 564 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aaggtaaagatgcacatcacgccctcctcgcatctcttctacttggccctgttcttgctc
accttcaccagctctgccacggctggacccgagaccctctgtggggctgagttggtggac
gcccttcagttcgtgtgcggagacaggggcttttatttcaacaagcccacggggtatggc
tcgagcagtcggagggcgcctcagacaggaatcgtggacgaatgctgcttccggagctgt
gatctgaggaggctggagatgtactgcgcgcctctcaagcctgccaagtcggcccgctct
gtccgtgcccagcgccacaccgacatgcccaaggctcagaagtatcagcccccatctacc
aacaagaaaacgaagtctcagaggagaaggaaaggtgggccaaagaaacatccaggaggg
gaacagaaggaggggacggaagcaagtcagcagatgaaaggaaagaagaaagagcagagg
agggagactggagctagaaactga

DBGET integrated database retrieval system