KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103014787
Entry
103014787         CDS       T03086                                 

Gene name
FRAT2
Definition
(RefSeq) FRAT2, WNT signaling pathway regulator
  KO
K03096  frequently rearranged in advanced T-cell lymphomas 2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04310  Wnt signaling pathway
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05200  Pathways in cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103014787 (FRAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103014787 (FRAT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103014787 (FRAT2)
   05226 Gastric cancer
    103014787 (FRAT2)
   05224 Breast cancer
    103014787 (FRAT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103014787 (FRAT2)
   05022 Pathways of neurodegeneration - multiple diseases
    103014787 (FRAT2)
SSDB
Motif
Pfam: GSK-3_bind
Other DBs
NCBI-GeneID: 103014787
NCBI-ProteinID: XP_007198674
LinkDB
Position
Un
AA seq 85 aa
LRGAVASRRLQQRRWPPAGARANDDDPHRLLQQLVLSGNLIKEAVRRLQRAVAAVAATGP
AAPPGPGGSRSRPDPVALXPSGALH
NT seq 258 nt   +upstreamnt  +downstreamnt
ctgcggggcgctgtcgcctcccgccgcctgcaacagcgacgatggcccccagccggggcg
cgcgccaacgacgacgacccgcacaggctcctgcagcagctggtgctctcggggaacctc
atcaaggaggccgtgcggaggctccagcgagccgtcgccgcggtagcagccacgggccct
gcggcaccccccggacccgggggcagccgcagccgaccggaccctgtcgccctttagccc
tccggcgccttgcactga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103015059
Entry
103015059         CDS       T03086                                 

Gene name
FRAT1
Definition
(RefSeq) FRAT1, WNT signaling pathway regulator
  KO
K03069  frequently rearranged in advanced T-cell lymphomas 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04310  Wnt signaling pathway
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05200  Pathways in cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103015059 (FRAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103015059 (FRAT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103015059 (FRAT1)
   05226 Gastric cancer
    103015059 (FRAT1)
   05224 Breast cancer
    103015059 (FRAT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103015059 (FRAT1)
   05022 Pathways of neurodegeneration - multiple diseases
    103015059 (FRAT1)
SSDB
Motif
Pfam: GSK-3_bind
Other DBs
NCBI-GeneID: 103015059
NCBI-ProteinID: XP_007187589
LinkDB
Position
Un
AA seq 187 aa
MDKPTEATPVSIFWKYRSRPAERARIGSPVPPADSIQGCRAQRHQGFTRDPCPEGASLRN
GTAQPLPGAVVGPGGNVTHCLQINPSRRLQQRRGLQPQARTGDDDPHRLLQQLVISGNLI
KEAVRRLHSRRLQLHAKLPRRQLLGPLSAPGHEPPLPRSPRAACSDPGSSGRRAQLRTGD
GVLVPGS
NT seq 564 nt   +upstreamnt  +downstreamnt
atggataaaccaacagaggccacgccggtgtccatcttctggaaataccgatcacgcccg
gccgagagagcgaggatcggctccccagtgccccccgcagacagcattcagggctgtaga
gctcagaggcatcaaggcttcacccgggacccctgcccagagggcgcctcgctccgcaac
ggtacggcgcaacccctccccggcgcggtggtagggcccggcggcaacgtcacccattgt
ttacaaatcaacccgagccgccgcctgcagcagcgacgcgggctacagcctcaagcccgc
accggcgacgacgacccgcaccggcttctgcagcagctcgtgatctcggggaacctcatc
aaggaggccgtgaggagacttcattcgcgacggctgcagttacacgcaaaacttccccga
cgccagctcctgggccctttgtcggccccagggcacgagccccctttgccccgcagccct
cgcgcggcctgcagcgaccctggctcgtctgggaggagggcgcagctcagaactggcgac
ggcgttctagttcccggcagctaa

DBGET integrated database retrieval system