KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103014916
Entry
103014916         CDS       T03086                                 

Gene name
SMAD4
Definition
(RefSeq) SMAD family member 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04068  FoxO signaling pathway
bacu04110  Cell cycle
bacu04310  Wnt signaling pathway
bacu04350  TGF-beta signaling pathway
bacu04371  Apelin signaling pathway
bacu04390  Hippo signaling pathway
bacu04520  Adherens junction
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04659  Th17 cell differentiation
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu05161  Hepatitis B
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05210  Colorectal cancer
bacu05212  Pancreatic cancer
bacu05220  Chronic myeloid leukemia
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103014916 (SMAD4)
   04350 TGF-beta signaling pathway
    103014916 (SMAD4)
   04390 Hippo signaling pathway
    103014916 (SMAD4)
   04371 Apelin signaling pathway
    103014916 (SMAD4)
   04068 FoxO signaling pathway
    103014916 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103014916 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103014916 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    103014916 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103014916 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103014916 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103014916 (SMAD4)
   05212 Pancreatic cancer
    103014916 (SMAD4)
   05225 Hepatocellular carcinoma
    103014916 (SMAD4)
   05226 Gastric cancer
    103014916 (SMAD4)
   05220 Chronic myeloid leukemia
    103014916 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103014916 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103014916 (SMAD4)
   05161 Hepatitis B
    103014916 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 103014916
NCBI-ProteinID: XP_007197312
UniProt: A0A384BC65
LinkDB
Position
Un
AA seq 553 aa
MDAMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPPSMLVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSAPALLAPSESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPLPPHPGH
YWPPVHNELAFQPPISNHPAPENXCSIAYFEMDVQVGETFKVPSSCPVVTVDGYVDPSGG
DRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAG
RAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIA
PAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEV
LHTMPIADPQPLD
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggacgctatgtctattacaaacacaccaacaagtaacgatgcctgtctgagcatcgtg
catagcttgatgtgccataggcaaggtggagagagcgagacctttgccaaacgagcgatt
gaaagtttggtgaagaaactgaaggagaaaaaagatgaactggattccttaataacagct
atcactacaaatggagctcaccctagcaaatgtgttactatacagagaacattggatgga
aggcttcaggtggctggtcggaaaggatttcctcatgtgatctatgcccgtctctggagg
tggcctgatcttcacaaaaacgaattaaaacatgttaaatattgtcagtatgcatttgac
ttaaaatgtgatagtgtctgtgtgaatccatatcactatgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccacctagtatgttggtgaaggat
gaatatgttcatgactttgagggacagccatcattatccactgaagggcattcaattcaa
accatccagcatccaccaagtaatcgtgcatcgacggagacctacagcgccccagctctc
ttagccccatctgagtctaacgctaccagcaccaccaactttcccaacattcctgtggct
tccacaagtcagcctgccagtatactggcaggcagccatagtgaaggattgttgcagata
gcttcagggcctcagccaggacaacagcagaatggatttactggtcagccagctacttac
catcataacagcactaccacctggactggaagtagaactgcaccatacacacctaatttg
cctcaccaccaaaacggccaccttcagcaccacccgcctctgccgccccatcccggacat
tactggccgccagttcacaatgagcttgcattccagcctcccatttctaaccatcctgct
cctgaaaattgatgttccattgcttactttgaaatggatgttcaagtaggagagacgttt
aaggttccttcaagctgtcctgttgttactgttgatggttatgtagacccttctggagga
gatcgcttttgcttgggtcaactctccaatgtccacaggacagaagccattgagagagca
aggttgcacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgatgtttgggtc
aggtgccttagtgaccacgcagtctttgtacagagctactacttagacagagaagctggg
cgtgcacctggagacgctgttcataagatctacccaagtgcatatataaaggtctttgat
ttgcgtcagtgtcatcgtcagatgcaacaacaggcagctactgcacaagctgcagcagct
gcccaggcagcagccgtggcaggaaacatccctggccccggatcagtaggtggaatagcc
ccagctatcagtttgtcagctgctgctggaatcggtgttgatgaccttcgtcgtttatgc
atactcaggatgagttttgtgaaaggctgggggcctgattacccaagacagagcatcaag
gaaacaccttgctggattgagattcacttacaccgggccctccagctcctagatgaagta
cttcacaccatgcctattgccgacccacagcctttagactga

DBGET integrated database retrieval system