KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103015316Help
Entry
103015316         CDS       T03086                                 

Gene name
HDAC11
Definition
(RefSeq) histone deacetylase 11
  KO
K11418  histone deacetylase 11 [EC:3.5.1.98]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu05034  Alcoholism
bacu05165  Human papillomavirus infection
bacu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    103015316 (HDAC11)
  09164 Substance dependence
   05034 Alcoholism
    103015316 (HDAC11)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    103015316 (HDAC11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bacu03036]
    103015316 (HDAC11)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103015316 (HDAC11)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     103015316 (HDAC11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 103015316
NCBI-ProteinID: XP_007183060
LinkDB All DBs
Position
Un
AA seq 347 aa AA seqDB search
MPHPTQLYQHVPESRWPIVYSPRYNITFLGLEKLHPFDAGKWGKVIGFLKEEKLLSDSML
VEAREASDEDLLVVHTRRYLNELKWSFAVATITEIPPVIFLPNFLVQRKVLKPLRTQTGG
TIMAGKLAMERGWAINVGGGFHHCSSDRGGGFCAYADITLAIKFLFERVEGVSRATIVDL
DAHQGNGHERDFMGDKRVYIMDVYNRHIYPGDRFAKQAIRRKVELEWGTEDDEYLRRVER
NLEKALQEHQPDVVVYNAGTDVLEGDRLGGLSISPQGVVKRDELVFRMVRGHQVPILMVT
SGGYQKRTARIIADSILNLYGQGLIGPQSANVSAQNSDTPLLPLEVP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgccacacccaacccagctgtaccagcatgtgccggagtcacgctggcccatcgtgtac
tcgccgcgctacaacataaccttcctgggcctggagaagctgcacccctttgatgcagga
aaatggggcaaagtgatcggcttcctaaaagaagagaagcttctatcagacagcatgctg
gtggaggcacgggaggcctcggacgaagacctgctggtggtgcacacgagacgctatctc
aacgagctgaagtggtcctttgctgtcgcaaccatcacagaaatcccccctgtcatcttc
ctgcccaacttcctggtacagaggaaggtgctgaagcccctccggacccagacgggagga
accataatggcggggaagctggccatggagcgaggctgggccatcaacgtaggcggcggc
ttccaccactgctccagcgaccggggcgggggcttctgcgcctacgcagacatcacgctc
gccatcaagtttctgtttgagcgagtggagggtgtctccagagccaccatcgttgatctc
gatgcccatcagggcaatgggcacgagcgggacttcatgggcgacaagcgcgtgtacatc
atggacgtctacaaccgccacatctaccccggggaccgctttgccaagcaggccatcagg
cggaaggtggagctggagtggggcacggaagatgatgagtacctgaggagggtggagagg
aacctggagaaagccctccaggagcatcagcccgacgtggtggtgtacaacgcaggcact
gacgtccttgagggggaccgcctcggggggctgtccatcagtccgcagggtgtcgtgaag
cgggatgagctggtgttccggatggtccgaggccaccaggtgcccatcctcatggtgacc
tcgggcgggtaccagaagcgtacagcccgcatcattgccgactccatccttaatttgtat
ggccaggggctcatcgggccccagtcagccaacgtctcagcacagaactcagacacaccc
ctgctgcccctggaggtgccctga

DBGET integrated database retrieval system