KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103015379Help
Entry
103015379         CDS       T03086                                 

Definition
(RefSeq) histone-lysine N-methyltransferase EZH1-like
  KO
K17451  histone-lysine N-methyltransferase EZH1 [EC:2.1.1.43]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103015379
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bacu03036]
    103015379
Enzymes [BR:bacu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103015379
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103015379
   Polycomb group proteins
    PRC2-EZH1 complex
     103015379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRC2_HTH_1 SET EZH2_WD-Binding preSET_CXC
Motif
Other DBs
NCBI-GeneID: 103015379
NCBI-ProteinID: XP_007177830
UniProt: A0A383ZRW4
LinkDB All DBs
Position
Un
AA seq 747 aa AA seqDB search
MDIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQILNEEW
KKLRVQPVQLMKPVSGHPFLKKCTIESIFPGFASQHMLMRSLNTVALVPIMYSWSPLQQN
FMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEMIPGSVLISDAVFLELV
DALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKKQFPNDMIFSAI
ASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGPNAKSVQREQSLHSFHTLFCR
RCFKYDCFLHPFHATPNVYKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGR
RRRRHHVVSASCSNTSASAVAETKEGDSDRDTGNDWASSSSEANSRCQTPTKQKASPAPP
QLCVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQVFQFAVKESLILK
LPTDELMNPSQKKKRKHRLWAAHCRKIQLKKDNSSTQVYNYQPCDHPDRPCDSTCPCIMT
QNFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWDCKVV
SCKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVYD
KYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAKRAIQAG
EELFFDYRYSQADALKYVGIERETDVL
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggatataccaaaccccccaacttccaaatgtatcacttactggaagaggaaggttaaa
tctgaatacatgcgacttcggcaacttaaacggcttcaggcgaatatgggtgcaaaggct
ctgtatgtagcaaattttgcaaaagttcaagaaaaaacccagatcctcaatgaagaatgg
aagaagcttcgtgtccagcctgttcagttgatgaagcctgtgagtgggcatccttttctc
aaaaagtgtaccatagagagcattttcccgggatttgcaagccagcatatgttaatgagg
tctctgaacacggttgcgttggttcccatcatgtattcctggtcccctctccagcagaac
tttatggtagaagatgagacggttttgtgcaatattccctacatgggagatgaggtgaaa
gaagaagatgagactttcattgaggagctgatcaataactacgatggcaaagtccatggt
gaagaagagatgattcccgggtctgtcctgattagtgatgctgttttcttggagttggta
gatgctctgaatcaatactcagatgaggaggaagaagggcacaatgacacctcagatgga
aagcaagatgacagcaaagaggatctgccagtaacaagaaagagaaaacgacatgctatt
gaaggcaacaaaaagagttccaagaaacagttcccaaatgacatgatcttcagtgcgatt
gcctcaatgttccctgagaatggtgtcccagatgacatgaaggagaggtatcgcgagctc
acagagatgtcagaccccaatgcgctcccccctcagtgcacacccaacatcgatggcccc
aatgctaagtctgtgcaacgggaacagtccctgcactccttccacacgctcttctgccgg
cgctgctttaaatacgactgcttccttcacccttttcatgccacccctaatgtatataaa
cgcaagaacaaagaaatcaagattgagccagaaccatgtggcacagactgcttccttttg
ctggaaggagcaaaggagtatgccatgctccacaaccctcgctccaagtgctccgggcgt
cgccggcgaaggcaccacgtggtcagtgcttcctgttccaacacttcagcctctgctgtg
gctgagaccaaagaaggggacagtgacagggacactggcaatgactgggcctccagttct
tcagaggctaactctcgctgtcagacccccacgaaacagaaggctagtccggccccacct
cagctctgtgtagtggaagcaccctcggagcctgtggagtggacgggggctgaagaatct
ctttttcgagtctttcatggcacctacttcaacaacttctgttcaatagccaggcttctg
gggactaagacgtgcaagcaggtcttccagttcgccgtcaaagaatcacttatcctgaag
ctgccaacagatgagctcatgaacccgtcacagaagaagaagagaaagcacaggctatgg
gctgcgcactgcaggaaaattcagctgaagaaagataactcctccacccaagtgtacaac
taccagccctgtgaccacccggaccgcccctgtgacagcacctgcccctgcatcatgact
cagaatttctgtgagaagttctgccagtgcaaccccgactgtcagaatcgctttcccggc
tgtcgctgtaagacccagtgcaacaccaagcagtgcccgtgctacctggcggtgcgagag
tgcgaccccgacctgtgtctcacctgtggggcctcggagcactgggactgcaaggtggtc
tcttgtaagaactgcagcatccagcgtggcctcaagaagcacctgctgctggccccctca
gatgtggccggatggggtaccttcattaaggagtctgtgcagaagaacgaattcatttct
gaatactgtggtgagctcatctctcaggatgaggctgatcgacgagggaaggtctatgac
aagtacatgtccagcttcctcttcaacctcaacaacgattttgtagtggatgctacccgg
aaaggaaacaaaattcgatttgcaaaccattcagtgaaccccaactgttacgccaaagtg
gtcatggtgaatggggatcatcggattgggatcttcgccaagagggcaattcaagctggc
gaagagctcttctttgattacaggtacagccaagctgatgccctcaagtacgtggggatc
gagagggagaccgatgtcctttag

DBGET integrated database retrieval system