KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103015439
Entry
103015439         CDS       T03086                                 

Gene name
MLH1
Definition
(RefSeq) mutL homolog 1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01524  Platinum drug resistance
bacu03430  Mismatch repair
bacu03460  Fanconi anemia pathway
bacu05200  Pathways in cancer
bacu05210  Colorectal cancer
bacu05213  Endometrial cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    103015439 (MLH1)
   03460 Fanconi anemia pathway
    103015439 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103015439 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103015439 (MLH1)
   05226 Gastric cancer
    103015439 (MLH1)
   05213 Endometrial cancer
    103015439 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103015439 (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bacu03400]
    103015439 (MLH1)
DNA repair and recombination proteins [BR:bacu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     103015439 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c DUF4921 Hfx_Cass5
Other DBs
NCBI-GeneID: 103015439
NCBI-ProteinID: XP_007191625
LinkDB
Position
Un
AA seq 748 aa
MSLVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVVIKEGGLKLIQ
IQDNGTGIRKEDLEIVCERFTTSKLQSFEDLAHISTYGFRGEALASISHVAHVSITTKTA
DGKCAYRAYYSDGKLKAPPKPCAGNQGTQITVEDLFYNISTRRKALKNPSEEYGKILEVV
GRYSVHNSGISFSVKKQGETVADVRTLPNATTVDNIRSIFGNAVSRELIEVGCEDKTLAF
KMNGYISNANYSVKKCIFLLFINHRLVESASLRKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEDSILERVQQHIESRLLGSNASRTYFTQTLLPGLTGPSGEVV
KSTTGVTLSSTAGSGDKVYAHQMVRTDCREQKLDAFLQPVSKALSSQPQAVVLEDRTAAS
SSGARQQDEEMFEISGLEEDATKRTADSSEKRGPSSSPENPRKRHRENSDVEMVEDASRK
EMTAACTPRRRIINLTSILSLQEEISEQGHETLREVLRNHSFVGCVNPQWALAQHQTKLY
LLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLA
EYIVEFLKKKAEMLADYFSLEIDEEGNLVGLPLLIDNYVPPLEGLPIFILRLATEVNWDD
EKACFESLGKECAMFYSIRKQYVSEESTLSGQQSEVPSSTPNPWKWTVEHVVYKAFHSHL
LPPKHFTEDGNILQLANLPDLYKVFERC
NT seq 2247 nt   +upstreamnt  +downstreamnt
atgtcgctggtagcgggggttatccggcggctggacgagacagtggtgaaccgcatcgcg
gcaggggaagttatccagcgcccggctaatgccatcaaggagatgattgagaactgttta
gatgcaaaatccacaagtattcaagtggttattaaagagggaggcctgaagttgattcag
atccaagacaatggcaccgggatcaggaaagaagatctggagattgtgtgtgagaggttc
accacaagtaaactgcagtcctttgaggatttagctcatatttctacctatggctttcgg
ggtgaggctttggccagcataagccatgtggctcatgtcagcattacaacgaaaacagct
gatgggaagtgtgcatacagagcatattactcagatggaaagctgaaagctccacctaaa
ccatgtgcaggcaatcaagggacccagatcacggtagaggaccttttttacaacatatcc
acgaggaggaaagctttaaaaaatccaagtgaagagtatgggaaaattctggaagttgtc
ggcaggtattcagtacacaattcgggcattagtttctcggttaaaaaacaaggtgagacg
gtagccgacgtcaggacactgcctaatgccacaaccgtggacaacattcgctccattttt
ggaaatgctgttagccgagaattgatagaagttgggtgtgaggataaaaccctcgccttc
aaaatgaatggctacatatccaatgcaaactactcggtgaagaagtgcatcttcttactc
ttcatcaatcatcgtctggtagagtcagcttccttaagaaaagccatagaaacggtgtat
gcagcatatttgcccaaaaacacacacccgttcctgtacctcagtttagaaatcagcccc
cagaatgtggatgtcaatgtgcaccccacgaagcacgaagttcacttcctgcacgaggac
agcatcctggagcgggtgcagcagcacattgagagcaggctcctgggctccaacgcctcc
aggacctatttcacccagactttactaccaggtcttactggcccctctggggaagtggtt
aaatccacaacaggtgtgaccctctcatctactgctggaagtggcgacaaggtgtatgcc
caccagatggtccgcacagattgccgggaacagaaactcgatgccttcctgcagcctgtg
agcaaggccctatccagtcagccccaggctgttgtcctagaggacaggacagctgcttct
agtagcggggccaggcagcaggatgaagaaatgtttgaaatctcaggcttggaggaggat
gcaacaaagaggactgcagactcgtcagagaagagagggccctcttccagccccgagaac
cccagaaagagacatcgggaaaactctgatgtggaaatggtggaggatgcatcccgaaag
gaaatgacagcagcttgtaccccccggagaaggatcattaacctcaccagcattctgagt
ctccaggaagaaatcagtgagcagggacatgagactctccgggaggtgctgcgtaaccac
tcgtttgtgggctgtgtgaatcctcagtgggccttggcacagcatcagaccaagttatac
cttctcaacaccaccaaacttagtgaagaactgttctaccagattctcatttatgatttt
gccaattttggtgttctgaggttatcggagccagcaccgctctttgacctcgccatgctt
gccttagatagtcctgagagtggctggacagaggaagatggtcccaaagaaggacttgcc
gaatacattgttgagtttctgaaaaagaaggctgagatgcttgcagactacttctctttg
gagattgatgaggaaggaaacctggttggattaccccttctgatcgacaactatgtgccc
cccttggagggtctgcctatcttcattctccgactggccactgaggtgaactgggatgac
gaaaaggcatgttttgaaagcctcggtaaagaatgtgcgatgttttactccatccggaag
cagtatgtgtctgaggagtcgaccctctcgggccagcagagtgaagtgcccagctctact
ccaaacccctggaagtggactgtggagcatgtcgtctataaagccttccattcacacctt
ctgcctccgaaacatttcacagaagatggaaacatcctgcagcttgctaatctgcccgat
ctatataaagtcttcgagaggtgttaa

DBGET integrated database retrieval system