KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103015537
Entry
103015537         CDS       T03086                                 

Gene name
IGF1R
Definition
(RefSeq) insulin like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04114  Oocyte meiosis
bacu04140  Autophagy - animal
bacu04144  Endocytosis
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04510  Focal adhesion
bacu04520  Adherens junction
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04730  Long-term depression
bacu04913  Ovarian steroidogenesis
bacu04914  Progesterone-mediated oocyte maturation
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05205  Proteoglycans in cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05218  Melanoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103015537 (IGF1R)
   04014 Ras signaling pathway
    103015537 (IGF1R)
   04015 Rap1 signaling pathway
    103015537 (IGF1R)
   04066 HIF-1 signaling pathway
    103015537 (IGF1R)
   04068 FoxO signaling pathway
    103015537 (IGF1R)
   04151 PI3K-Akt signaling pathway
    103015537 (IGF1R)
   04152 AMPK signaling pathway
    103015537 (IGF1R)
   04150 mTOR signaling pathway
    103015537 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103015537 (IGF1R)
   04140 Autophagy - animal
    103015537 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103015537 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103015537 (IGF1R)
   04520 Adherens junction
    103015537 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    103015537 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    103015537 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    103015537 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    103015537 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    103015537 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    103015537 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103015537 (IGF1R)
   05202 Transcriptional misregulation in cancer
    103015537 (IGF1R)
   05205 Proteoglycans in cancer
    103015537 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103015537 (IGF1R)
   05214 Glioma
    103015537 (IGF1R)
   05218 Melanoma
    103015537 (IGF1R)
   05215 Prostate cancer
    103015537 (IGF1R)
   05224 Breast cancer
    103015537 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103015537 (IGF1R)
   01522 Endocrine resistance
    103015537 (IGF1R)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103015537 (IGF1R)
Protein kinases [BR:bacu01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   103015537 (IGF1R)
CD molecules [BR:bacu04090]
 Proteins
  103015537 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD DUF4476
Other DBs
NCBI-GeneID: 103015537
NCBI-ProteinID: XP_007191236
LinkDB
Position
Un
AA seq 1345 aa
MVSFEAGCRICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVIT
EYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIR
IEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPLCEKTTINNEYN
YRCWTTNRCQKMCPSACGKRACTENHECCHPECLGSCSAPDNDTACVACRHYYYAGVCVP
SCPPNTYRFEGWRCVDRDFCANIPNAESSDSEGFVIHDGECMQECPSGFIRNGSQSMYCI
PCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASELENFMGLIE
VVTGYVKIRHSHALVSLSFLKNLRQILGEEQLEGNYSFYVLDNQNLQQLWDWDHRNLTIK
AGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERASCESDVLHFTSTTTWK
NRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKDV
EPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNASVPSIPLDVLSASN
SSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDSYLYRHNYCSKDKIPIRKYADGTIDVEE
VTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRKVFENFLHNAIFVPRPERKRREV
MQVANTTMSSRSRNTTVVDTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRID
IHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLI
LMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFF
YVQAKTTYENFIHLIIALPIAVLLIVGGLVIMLYVFHRKRNNSRLGNGVLYASVNPEYFS
AADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMR
ERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNP
VLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYE
TDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATLAEQPYQGLSNEQVL
RFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKDEMEPGFREVSFYYS
EENKPPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGHKAENGPGPGVLVLRASFDE
RQPYAHMNGGRKKERALPLPQSSTC
NT seq 4038 nt   +upstreamnt  +downstreamnt
atggtgtcctttgaggctggctgcaggatctgtgggccaggcatcgacatccgcaacgac
taccagcagctgaagcgactggagaactgcacggtgatcgagggctacctccatatcctg
ctcatttccaaggctgaggactaccgcagctaccgcttccccaagctcacggtcatcact
gagtacctgctgctgttccgcgtggctggcctcgagagcctcggcgacctcttccccaac
ctcacagtcatccgtggctggaagctcttctacaactacgccctggtcatcttcgagatg
accaacctcaaggatatcgggctctacaacctgcgaaacattacccgtggggccatccgg
atcgagaagaatgctgacctctgctacctctccacggtggactggtccctaatcctggat
gccgtgtccaataactacattgtggggaataagcccccaaaggagtgtggggacctgtgc
ccggggacgatggaggagaagccgctgtgcgagaagacgaccatcaacaacgagtacaac
taccgctgctggaccacgaaccgctgtcagaaaatgtgcccgagcgcgtgcgggaagcgg
gcgtgcacggagaaccacgagtgctgccaccccgagtgcctgggcagctgcagcgctccc
gacaacgacacggcctgcgtggcctgccgccactactactatgccggtgtctgtgtgccc
agctgcccgcccaacacctaccgcttcgagggctggcgttgcgtggaccgtgacttctgc
gccaacatccccaacgctgagagcagcgattccgagggcttcgtgatccacgatggcgag
tgcatgcaggagtgcccgtcgggcttcatccgcaacggcagccagagcatgtactgcatc
ccttgcgaaggcccttgtcccaaagtgtgtgaggaagaaaagaagacaaagaccattgat
tctgtcacttctgctcagatgctccaaggatgcaccatcttcaagggcaatctactcatt
aatatccgacgcggcaacaacatcgcttcagaactggagaacttcatgggactcatcgag
gtcgtgacgggctacgtgaagatccgccactcccatgccttggtctccttgtccttcctg
aagaaccttcgccagatcctaggagaggagcagctagaggggaattactccttctacgtc
ctcgacaaccagaacttgcagcagctgtgggactgggaccaccgcaacctgaccatcaaa
gctgggaaaatgtactttgctttcaatcccaaattgtgtgtctccgagatttaccgcatg
gaggaagtgacagggactaaaggacgccagagcaaaggggacataaacaccaggaacaac
ggagagagagcctcctgtgaaagtgacgtcctgcacttcacctccaccaccacgtggaag
aaccgcatcatcatcacctggcaccggtaccggccccctgactacagggacctcatcagc
ttcaccgtctactacaaggaagcaccctttaaaaacgtcacagagtatgacgggcaggat
gcctgcggctccaacagctggaacatggtagatgtggacctcccacccaacaaggacgtg
gagcccggcattttactgcatggactgaagccctggacacagtatgccgtttacgtcaag
gctgtgaccctcaccatggtggagaatgaccacatccgtggagccaagagcgagatcttg
tacattcgcaccaatgcttcagttccttccatccccctggatgtactctcagcatcaaac
tcctcttctcagctgatcgtgaagtggaaccctccttccctgcccaacggcaacctgagc
tactacatcgtgaggtggcagcgccagccccaggacagctacctttaccggcacaattac
tgctccaaagacaaaatccccatcaggaagtacgccgacggcaccatcgacgttgaggag
gtgacggagaatcctaagaccgaagtgtgtggtggggagaaagggccgtgctgcgcttgc
cccaagaccgaagccgagaagcaggccgagaaggaggaggccgagtaccgcaaggtcttc
gagaatttcctgcacaacgccatcttcgtgcccagacctgaacggaagcggagggaggtc
atgcaggtcgccaacaccaccatgtccagccggagcaggaacaccacggtggtggacacc
tacaacatcacagacccggaagagctcgagaccgagtaccctttctttgagagcagagtg
gataacaaggagagaactgtcatctccaacctccggccttttactctgtaccgaatcgat
atccacagctgtaaccacgaagctgagaagctcggctgcagcgcctccaactttgtcttt
gcaagaaccatgcctgcagaaggagcagatgacattcctgggccagtgacctgggagcca
aggcctgagaactccatctttttaaaatggccagaacctgagaatcccaatggattgatt
ttaatgtatgaaataaaatacggatcacaagtcgaggatcagcgggaatgtgtgtccaga
caggagtacaggaagtatggaggggccaagctaaaccggctgaacccggggaactacacg
gcccggatccaggccacctctctctctgggaacgggtcgtggactgatcctgtgttcttc
tatgtccaggccaaaacaacgtatgaaaacttcatccatctgatcatcgctctgcccatt
gctgttctgctgatagtaggagggttggttataatgctgtacgtcttccatagaaaaaga
aataacagcaggctggggaacggagtgctgtatgcctctgtgaacccggagtacttcagt
gcagccgatgtgtacgtgcctgacgagtgggaggtcgcccgggagaagatcaccatgagc
cgggagctggggcagggctccttcgggatggtttacgaaggtgtcgccaagggcgtggtc
aaggatgagcctgagaccagggtggccattaagacggtgaacgaggccgccagcatgcgc
gagaggattgagtttctcaacgaggcctcggtgatgaaggagttcaactgtcaccacgtg
gtgcgcttgctgggtgtggtgtcccagggccagccgacgctggtcatcatggaactgatg
acccggggggacctcaaaagttatctccggtctctgaggccagaaatggagaataatcca
gtcctagcacctcccagcctaagcaaaatgatccagatggctggagagattgcagatggc
atggcatacctcaacgccaataagtttgtccacagagacctcgctgcccggaactgcatg
gtggccgaagatttcacagtcaaaatcggagattttgggatgacgagagacatctatgag
accgactattaccggaagggagggaaggggctgctgcctgtgcgctggatgtcccccgag
tccctcaaggatggagtcttcaccacgcactctgacgtctggtccttcggggtcgtcctc
tgggagatcgccacgctggccgagcagccataccagggcctgtccaatgagcaagtcctt
cgcttcgtcatggagggcggccttctggacaagccggacaactgtcctgacatgctgttt
gaactgatgcgcatgtgctggcagtacaaccccaagatgaggccttccttcctggagatc
atcagcagcatcaaggacgagatggagcccggcttccgggaggtctccttctactacagc
gaggagaacaagccgcctgagccagaggagctggacctagagccggagaacatggagagt
gtccccctggacccctcggcctcctcgtcctccctgccgctgcccgacagacactcagga
cacaaggccgagaacggtccgggccctggcgtgctggtccttcgagccagcttcgacgag
agacagccttatgcgcacatgaatgggggccgcaagaaggagcgggccttgcctctgccc
cagtcctcgacctgctga

DBGET integrated database retrieval system