KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103015542
Entry
103015542         CDS       T03086                                 

Gene name
BCL2
Definition
(RefSeq) BCL2, apoptosis regulator
  KO
K02161  apoptosis regulator Bcl-2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu01524  Platinum drug resistance
bacu04064  NF-kappa B signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04071  Sphingolipid signaling pathway
bacu04115  p53 signaling pathway
bacu04140  Autophagy - animal
bacu04141  Protein processing in endoplasmic reticulum
bacu04151  PI3K-Akt signaling pathway
bacu04210  Apoptosis
bacu04215  Apoptosis - multiple species
bacu04217  Necroptosis
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04340  Hedgehog signaling pathway
bacu04510  Focal adhesion
bacu04621  NOD-like receptor signaling pathway
bacu04630  JAK-STAT signaling pathway
bacu04722  Neurotrophin signaling pathway
bacu04725  Cholinergic synapse
bacu04915  Estrogen signaling pathway
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu05014  Amyotrophic lateral sclerosis
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05132  Salmonella infection
bacu05145  Toxoplasmosis
bacu05152  Tuberculosis
bacu05161  Hepatitis B
bacu05162  Measles
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
bacu05215  Prostate cancer
bacu05222  Small cell lung cancer
bacu05226  Gastric cancer
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103015542 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    103015542 (BCL2)
   04630 JAK-STAT signaling pathway
    103015542 (BCL2)
   04064 NF-kappa B signaling pathway
    103015542 (BCL2)
   04066 HIF-1 signaling pathway
    103015542 (BCL2)
   04071 Sphingolipid signaling pathway
    103015542 (BCL2)
   04151 PI3K-Akt signaling pathway
    103015542 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103015542 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    103015542 (BCL2)
   04215 Apoptosis - multiple species
    103015542 (BCL2)
   04217 Necroptosis
    103015542 (BCL2)
   04115 p53 signaling pathway
    103015542 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103015542 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103015542 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103015542 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    103015542 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103015542 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    103015542 (BCL2)
   04722 Neurotrophin signaling pathway
    103015542 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103015542 (BCL2)
   05206 MicroRNAs in cancer
    103015542 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103015542 (BCL2)
   05226 Gastric cancer
    103015542 (BCL2)
   05215 Prostate cancer
    103015542 (BCL2)
   05222 Small cell lung cancer
    103015542 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103015542 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    103015542 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103015542 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103015542 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103015542 (BCL2)
   05152 Tuberculosis
    103015542 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103015542 (BCL2)
   05161 Hepatitis B
    103015542 (BCL2)
   05162 Measles
    103015542 (BCL2)
   05168 Herpes simplex virus 1 infection
    103015542 (BCL2)
   05169 Epstein-Barr virus infection
    103015542 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103015542 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103015542 (BCL2)
   01524 Platinum drug resistance
    103015542 (BCL2)
   01522 Endocrine resistance
    103015542 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bacu01009]
    103015542 (BCL2)
Protein phosphatases and associated proteins [BR:bacu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103015542 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 103015542
NCBI-ProteinID: XP_007192071
UniProt: A0A384AXC0
LinkDB
Position
Un
AA seq 233 aa
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGTASPGAAPAPGIFSSQPGRTPAPS
RTSPPPPQTAPAAPGGGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTA
RGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLH
TWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACVTLGAYLGHK
NT seq 702 nt   +upstreamnt  +downstreamnt
atggcgcacgctgggagaacaggctatgataaccgggagatagtgatgaagtacatccac
tataagctgtcgcagaggggctacgagtgggatgccggagacgcgggcaccgcgtccccg
ggggccgcccccgcgccaggcatcttctcctcccagcctgggcgcaccccagcgccatcc
aggacctccccgccgccgccccagaccgcccccgccgccccgggcggggggcctgctctc
agccccgtgccacctgtggtccacctgaccctgcgccaggccggtgatgatttctctcgt
cgctaccgccgcgacttcgcagagatgtccagccagctgcacctgacgcccttcaccgcg
aggggacgctttgccacggtggtggaggagctcttcagggatggggtgaactgggggagg
attgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaaccgggagatg
tcccccctggtggacaacatcgccctgtggatgactgagtacctgaaccgacacctgcac
acctggatccaggataacggaggctgggatgcctttgtggagctgtatggtcccagcatg
cggcctctgtttgatttctcctggctgtctctgaaggcactgctcagtctggccctggtg
ggagcttgcgtcaccctgggtgcctatctgggccataagtga

DBGET integrated database retrieval system