KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103015566
Entry
103015566         CDS       T03086                                 

Gene name
STK11
Definition
(RefSeq) serine/threonine kinase 11
  KO
K07298  serine/threonine-protein kinase 11 [EC:2.7.11.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04068  FoxO signaling pathway
bacu04140  Autophagy - animal
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04211  Longevity regulating pathway
bacu04530  Tight junction
bacu04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103015566 (STK11)
   04151 PI3K-Akt signaling pathway
    103015566 (STK11)
   04152 AMPK signaling pathway
    103015566 (STK11)
   04150 mTOR signaling pathway
    103015566 (STK11)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103015566 (STK11)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103015566 (STK11)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103015566 (STK11)
  09149 Aging
   04211 Longevity regulating pathway
    103015566 (STK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103015566 (STK11)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103015566 (STK11)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   103015566 (STK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 103015566
NCBI-ProteinID: XP_007176742
UniProt: A0A383ZNP4
LinkDB
Position
Un
AA seq 454 aa
MEVADPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY
GKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE
EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLVDGLEYLHSQGIVHKDIKPG
NLLLTTGGTLKISDLGVAEALHPFAEDDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS
AGVTLYNITTGLYPFEGDNIYKLFENIGKGDYTIPGDCGPPLSDLLKGACLGVDGREPHQ
HPGAWPKLVLMTQHIQGIALFDRWFRKKHPPAEEPVPIPPSADCKDRWRGMTVVPYLEDL
HGCADATDDELFDIEDDIIYTQDFTVPGQVPEEEAGRSTQSRGPHKAVCVNGTESAQLSA
RSRAERRASAASNPARKACSASSKIRRLSACKQQ
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggaggtggctgacccgcagcagctgggcatgtttacagagggcgagctgatgtcggtg
gggatggacacgttcatccaccgcatcgactccaccgaggtcatctaccagccccgccgc
aagcgggccaagctcatcggcaagtacctgatgggggacctgctgggggaggggtcgtac
ggcaaggtgaaggaggtgctggactcggagacgctgtgccggagagccgtcaaaattctc
aagaagaagaagttgcggaggatccccaacggggaggccaacgtaaagaaggaaatccag
ctgctgaggaggttacggcacaaaaacgtcatccagctggtggacgtgctgtacaacgag
gagaagcagaagatgtatatggtgatggagtactgcgtgtgtggcatgcaggagatgctg
gacagcgtgcccgagaagcgcttccccgtgtgccaggcccacgggtacttctgccagctg
gtggacggcctggagtacctgcatagccagggcatcgtgcacaaggacatcaagcccggc
aacctgctgctcaccacgggtggcacgctcaagatctccgacctcggtgtggccgaggcc
ctgcacccgtttgccgaggacgacacgtgccggacgagccagggttcccccgcattccag
ccgcccgagatcgccaacggcctggacaccttctctggcttcaaggtggacatctggtca
gctggggtcacgctctacaacatcacgacaggcctgtacccgttcgagggagacaacatt
tacaagctgtttgagaacatcgggaagggagactacaccatcccgggggattgcggcccc
ccactctcagacctgctcaaaggggcctgtctaggtgtggatgggcgggagccacaccag
catcctggggcttggccgaagttagttttgatgacgcagcacatccagggtatcgccctg
tttgaccgctggttccggaagaagcacccaccggccgaggagccagtgcctatcccgccg
agcgcggactgcaaggaccggtggcgcggcatgacggtggtgccctacctggaggacctg
cacggctgcgccgacgccacagatgacgagctcttcgacatcgaggacgacatcatctac
actcaggacttcacggtgcccggacaggtcccggaggaggaggccgggcggagcacacag
agccggggcccgcacaaagccgtgtgtgtgaacggcaccgagtcagcccagctgagcgcc
aggtcgagggcggagcgccgggccagcgccgcctccaaccccgcccgcaaggcctgctcg
gccagcagcaagatccgccggctgtcggcctgcaagcagcagtga

DBGET integrated database retrieval system