KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103015759
Entry
103015759         CDS       T03086                                 

Gene name
TLR4
Definition
(RefSeq) toll like receptor 4
  KO
K10160  toll-like receptor 4
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04064  NF-kappa B signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04145  Phagosome
bacu04151  PI3K-Akt signaling pathway
bacu04217  Necroptosis
bacu04613  Neutrophil extracellular trap formation
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu05132  Salmonella infection
bacu05133  Pertussis
bacu05134  Legionellosis
bacu05135  Yersinia infection
bacu05140  Leishmaniasis
bacu05142  Chagas disease
bacu05144  Malaria
bacu05145  Toxoplasmosis
bacu05146  Amoebiasis
bacu05152  Tuberculosis
bacu05161  Hepatitis B
bacu05162  Measles
bacu05164  Influenza A
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05205  Proteoglycans in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05321  Inflammatory bowel disease
bacu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103015759 (TLR4)
   04066 HIF-1 signaling pathway
    103015759 (TLR4)
   04151 PI3K-Akt signaling pathway
    103015759 (TLR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    103015759 (TLR4)
  09143 Cell growth and death
   04217 Necroptosis
    103015759 (TLR4)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103015759 (TLR4)
   04620 Toll-like receptor signaling pathway
    103015759 (TLR4)
   04621 NOD-like receptor signaling pathway
    103015759 (TLR4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103015759 (TLR4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103015759 (TLR4)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103015759 (TLR4)
   05321 Inflammatory bowel disease
    103015759 (TLR4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103015759 (TLR4)
   05135 Yersinia infection
    103015759 (TLR4)
   05133 Pertussis
    103015759 (TLR4)
   05134 Legionellosis
    103015759 (TLR4)
   05152 Tuberculosis
    103015759 (TLR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103015759 (TLR4)
   05161 Hepatitis B
    103015759 (TLR4)
   05171 Coronavirus disease - COVID-19
    103015759 (TLR4)
   05164 Influenza A
    103015759 (TLR4)
   05162 Measles
    103015759 (TLR4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103015759 (TLR4)
   05144 Malaria
    103015759 (TLR4)
   05145 Toxoplasmosis
    103015759 (TLR4)
   05140 Leishmaniasis
    103015759 (TLR4)
   05142 Chagas disease
    103015759 (TLR4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103015759 (TLR4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:bacu04054]
    103015759 (TLR4)
   04090 CD molecules [BR:bacu04090]
    103015759 (TLR4)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103015759 (TLR4)
Membrane trafficking [BR:bacu04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    103015759 (TLR4)
Pattern recognition receptors [BR:bacu04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   103015759 (TLR4)
CD molecules [BR:bacu04090]
 Proteins
  103015759 (TLR4)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Hyaluronan
  Cell surface receptors
   103015759 (TLR4)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_9 DUF1863 LRR_6
Other DBs
NCBI-GeneID: 103015759
NCBI-ProteinID: XP_007178193
UniProt: A0A383ZSV1
LinkDB
Position
Un
AA seq 841 aa
MMPRTRLAAALIPAMALLFCLRSEGWDPCVQVVPNISYQCMELNLYKIPDNIPTSTKILD
LSFNHLSHLNSHSFSNFPELQMLDLSRCEIQMIEDDAYQGLNHLSTLILTGNPIQSLALG
AFSGLSSLEKLVAVETNLASLEDFPIGHLKTLKELNVAHNLIHSFKFPEYFSNLPNLEHL
DLSNNKIQNVYHEDLKVLHQMPLLNLSLDLSLNPLDFIEPGTFKEIKLNELTLRSNFNST
HVMKTCIQGLAGLKINRLVLGEFKNERNLQSFDRSVLEGLCNLTFEKFRIAYFSEFPRDD
IGLFNCLVNVSMISLLSLDLDSLEALPKDCRWQHLELINCNFKQFPTLKLNSLKKFVFID
NKGMSTFTEFELPNLQFLDLKRNRLSFKGCCSHTNFGTTKLKHLDLSFNDVITMNSNFLG
LEQLEHLDFQHSNLKQANDFSVFLSLRNLRYLDISYTNTRVVFHGIFVGLVRLQTLKMAG
NSFQNNLLPDIFTELTNLIILDLSKCQLEQVSQMAFHSLPRLQVLNMSHNKLLSLDTLPY
KPLHSLRILDCSFNRIMESKEQELQHLPRSLALLNLTQNDFACVCEHQSFLQWVKDQRQL
LVGAEQMMCTQPLDMQDMPVLSFRNATGQMNKMIISVSVLTVLLVSVAGVLVYKFYFHLM
LLAGCKKYGRGESTYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIA
ANIIQEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLHKLEKSLL
RQQVELYRLLNRNTYLEWEDSVLGRHIFWRRLRKALLDGKPWRPEGTADADSREQEATAS
T
NT seq 2526 nt   +upstreamnt  +downstreamnt
atgatgcctcgcacccgcctggctgcggctctgatcccagccatggccctcctcttctgc
ctgaggtcggagggctgggacccttgcgtacaggtggttcctaacattagttaccaatgc
atggagctgaatctctacaaaatccctgacaacatccccacatcgaccaagatactggac
ctgagctttaaccacctgagtcatttaaacagccatagcttctccaacttcccagaactg
cagatgttggatttatccagatgtgaaattcagatgattgaagatgatgcatatcagggc
ctaaaccacctctccaccttgatattgacaggaaaccctatacagagtttagccctggga
gccttttctgggctatcaagtttagagaagctggtagccgtggagacaaacctagcatct
ctagaggacttccccattggacatctcaaaaccttgaaggagcttaatgtggctcacaat
cttatccattccttcaagtttcctgaatatttttctaacctgcccaacctggagcacttg
gatctttctaataacaaaatccaaaatgtgtatcatgaagacttgaaggttctccatcaa
atgcccctgctcaacctctctttagatttgtccctgaaccctttagactttattgaacca
ggtacctttaaagaaattaagctcaatgaactgactttgcgaagtaattttaatagtaca
catgtaatgaaaacttgtattcaaggtctggctggtttaaaaatcaatcggttggttttg
ggagaatttaaaaatgaaaggaacttgcaaagttttgacagatctgtcctggagggactg
tgcaatttgaccttcgaaaaatttcggatagcatacttcagtgaattcccaagggatgat
ataggcttatttaattgtttggtaaatgtttctatgatttctctgttgagtctggattta
gacagtctagaagcccttcctaaagactgcagatggcaacacttagaattgattaactgt
aattttaaacaatttcccacattgaagctcaattctctcaaaaagtttgttttcatagac
aacaaaggtatgagcacttttactgaatttgagctaccaaaccttcagtttctagatctc
aaaagaaatcgcttgagtttcaagggttgctgttctcacactaattttgggacaaccaaa
ctgaagcatttagatctgagcttcaatgatgtcattactatgaattcaaacttcttgggc
ttagagcaactagaacatctggattttcagcattccaatctgaaacaggccaatgatttt
tcagtattcctatcactcagaaacctccgttaccttgatatttcttataccaacacccga
gttgtcttccatggcatctttgttggcttggtccgcctccaaaccttgaaaatggcaggc
aattcttttcagaacaacttgcttcctgatatcttcacagaactgactaacttaatcatc
ctggacctctctaagtgtcaactggaacaggtatcccagatggcatttcactccctccct
agacttcaggtgctaaatatgagtcacaacaaactcttgtcattggatacacttccttat
aaaccactccactccctccggattctggattgcagtttcaaccgtatcatggagtccaag
gagcaagaactacagcatttgccaaggagccttgctttgttaaatcttactcagaatgac
tttgcttgtgtttgtgaacaccagagtttcctgcagtgggtcaaggaccagaggcagctc
ttggtgggagctgagcaaatgatgtgtacgcaacctttagatatgcaggacatgcccgtg
cttagtttcaggaatgccactggtcagatgaacaagatgatcattagtgtgtcggttctc
accgtcctcttggtatctgtggcaggagtcctggtctataagttctatttccacctaatg
cttcttgctggctgcaaaaagtatggcagaggtgaaagcacctatgatgcttttgtaatc
tactcaagccaggacgaagactgggtgaggaatgaattggtaaagaacttggaggagggg
gttcccccctttcagctctgccttcactacagagactttattcctggggtggccattgcc
gccaacatcatccaggaaggtttccacaaaagccggaaggttattgtcgtggtgtcccag
cacttcatccagagccgatggtgtatctttgagtatgagattgcccagacctggcagttt
cttagcagccgtgctggcatcatcttcatagtcctgcacaagttggagaagtccctgctg
cggcagcaggtagagctgtaccgcctcctcaacaggaatacctacctggagtgggaggac
agtgtcctggggcggcacatcttctggagacgactcagaaaagccttgctggacggtaaa
ccatggaggccagaaggaacagcagatgcagacagcagagagcaggaagcaacagcctcc
acttga

DBGET integrated database retrieval system