KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103016185
Entry
103016185         CDS       T03086                                 

Gene name
PLCE1
Definition
(RefSeq) phospholipase C epsilon 1
  KO
K05860  phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00562  Inositol phosphate metabolism
bacu01100  Metabolic pathways
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04024  cAMP signaling pathway
bacu04070  Phosphatidylinositol signaling system
bacu04919  Thyroid hormone signaling pathway
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu05205  Proteoglycans in cancer
Module
bacu_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103016185 (PLCE1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103016185 (PLCE1)
   04015 Rap1 signaling pathway
    103016185 (PLCE1)
   04020 Calcium signaling pathway
    103016185 (PLCE1)
   04070 Phosphatidylinositol signaling system
    103016185 (PLCE1)
   04024 cAMP signaling pathway
    103016185 (PLCE1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103016185 (PLCE1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103016185 (PLCE1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103016185 (PLCE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103016185 (PLCE1)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     103016185 (PLCE1)
Membrane trafficking [BR:bacu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103016185 (PLCE1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    103016185 (PLCE1)
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y RasGEF RA C2 EF-hand_like
Other DBs
NCBI-GeneID: 103016185
NCBI-ProteinID: XP_007187591
UniProt: A0A384AJP6
LinkDB
Position
Un
AA seq 1973 aa
MEGRFLMNQSAVFLGDRSGRVTQEGPEGQKGKVCPCPATDELYSAEEEEEKFELNIFLIY
SAVRRGEETEETIRSLLHFFTKLPASETAHERISIGPCLKQCVQDTVCEYRATLQRTSIS
QYITGSLLEATTSLGARSNLLNSFGGSTGRMMLKERQPGTSMANPSALPSSSAGISKELI
DLQPLIQFPEEVASILMEQEQNIYRRVLPVDYLCFLTRDLGTTECQRSLPCLKASISASI
LTSQNGEHNALEDLVMRFNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNA
VMEFLAGLRSRKVLKMWQFMDQSDLETMRSLKDAMAQHESSCEYRKVVTRALHIPGCKVV
PFCGVFLKELCEVLDGASGLMKLCPRYNSQEETLEFVADYSGQDNFLQRVGQNGLKNSEK
ESTVNSIFQIIRSCSRSLETEEEDSSSEGNSSRKNSLKDKARWQFIIGDLLDSENDIFEQ
PQEWDPHASEEPQKAFDHGTELIPWYVLSIQADVHQFLLQGATVIHYDQDMHLSARCFLQ
LQPDNSTLTWIKPTTASPASAKAKLGVLSNTSEPGKFPLLGNAGLSGLAEGVLDLFSAKA
VYMGHPSIDIHTVCVQNKLSNMSLSETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLL
ELTRAVRKMRKFPDQRQQWLRKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSTRNPSPGT
SAKSAEKPNVQRNNTLGISTTKKKKKILMRGESGEATDDEMATRKAKTHKECRSRSGSDP
QDVNEQEESEANAITSPPNPLPSRRAHSLTTAGSPNLAAGTSSPIRPVSSPVLSSSNKSP
SSAWSSSSWHGRIKGGMKGFQSFMVSDSSMSFVEFVELFKSFSVRSRKDLKDLFDIYAVP
CDRAGSEAAPLYTNLTIDENTSGLQPDLDLLTRNVSDLGLFIKSKQQLSDNQRQISDAIA
AASIVTNGTGVESTSLGVFGVGILQLNDFLVNCQGEHYTYDEILSIIQKFEPSISMCHQG
LMSFEGFARFLMDKDNFASKNDESQENIKELQLPLSYYYIESSHNTYLTGHQLKGESSVE
LYSQVLLQGCRSVELDCWDGDDGMPIIYHGHTLTTKIPFKEVVEAIDRSAFINSDLPIII
SIENHCSLPQQRKMAEIFKTVFGEKLVAKFLFESDFSDDPMLPSPDQLRRKVLLKNKKLK
AHQTPVDILKQKAHQLASMQAQAYNGGSANPPPANNEEEEDEEDEYDYDYESLSDADVLT
ASPAPNSQEDNILEDRPENKSCNDKLQFEYNEEIPKRIKKADNSACNKGKVYDMELGEEF
YLPQNKKESRQIAPELSDLVIYCQAVKFPGLSTLNASGSSRGKERKSRKSIFGNNPGRMS
PGETASFNKTSGKNSCEGMRQAWEDSPSSVNPTTSLSAIIRTPKCYHISSLNENAAKRLC
RRYSQKLIQHTACQLLRTYPAATRIDSSNPSPLLFWLHGIQLVALNYQTDDLPLHLNAAM
FEANGGCGYVLKPPVLWDKNCPMYQKFSPLERDLDNMESAVYSLTIVSGQNVCPSNSTGS
PCIEVDVLGMALDSCHFRTKPIHRNTLNPMWNEQFLFRVHFEDLLFLRFAVVENNSSVVT
AQRIIPLKALKRGYRHLQLRNLHNEVLEISSLFINSRRMEENSSGNTMPASLMFNTEERK
CLQIHRVTVHGVPGPEPFAVFSINGGTKAKQLLQQSLTIDQDTKPIATDYFLMEEKYFIS
KEKNECRKQPFQRAIGPEEEIMQILSSWFPEEGYVGRIVLKTQQENLEEKSIVQDDKEMI
LSSEEESFFVQVHDVSPEQPRTVIKAPRISTAQDVIQQTLCKAKYSYSILSNPNPGDYVL
LEEVVKDTANRKSSTPKSSQRVLLDQECVFQAQSRWKGAGKFILKLKEQVQASREDKRKG
ISFASELKKLTKSTKQPRGLTSSSQVLASENVQNKEEKPVGSMSSSDTIDYRQ
NT seq 5922 nt   +upstreamnt  +downstreamnt
atggagggaagattcctcatgaatcagtctgcagtgttccttggagatagatctgggaga
gtcactcaggagggtccagaaggacaaaaaggaaaggtttgcccttgtcccgctacagac
gagctttattctgctgaggaggaggaggagaaatttgagctgaatatatttttgatctac
agtgcagtgagaaggggagaagaaacagaagagacaattagatctcttctccatttcttc
acaaagctcccagcctccgagacagcccatgaaaggattagcattggtccgtgcttaaag
caatgtgtccaagacactgtttgtgagtatcgtgccaccctccaaaggacttccatatct
cagtacatcaccggctctctcctagaagccaccacatctttaggagcaagaagtaacctt
ctcaattcttttggaggatccaccggacgaatgatgctgaaagaacgccagccaggcacc
tctatggccaatcccagtgccctcccttcaagttcagctgggatcagcaaggagctgatt
gatctgcagcccctcatccagttcccagaggaagttgccagcatcctgatggaacaggag
cagaatatttaccgaagggtcttgccggttgactatctttgcttcttgacccgggacttg
ggcaccacggaatgccagaggtccctgccctgcctcaaagcgtccatctcagcatccatt
cttacctcccagaacggagagcataatgcccttgaagatcttgtgatgaggtttaatgag
gtgagctcctgggtgacgtggctgatcctcacggcgggctccatggaggagaagcgggaa
gtcttctcgtatttggtgcatgtggccaaatgctgctggaacatgggcaactacaacgcc
gtcatggagttcttggccggcctcaggtcaagaaaagttttaaaaatgtggcagtttatg
gaccagtctgacctggagacgatgaggagcctgaaggacgccatggcccagcatgaatct
tcctgcgagtacaggaaggtggtgactcgggcgctgcacatccccggctgtaaggtggtt
ccgttctgcggggtgtttctgaaggagctctgtgaggtgcttgacggagcctccggcctc
atgaagctttgcccgaggtacaattcccaagaagaaactctagagtttgtagccgattac
agtggacaagataatttcttacaacgagtgggacagaatggcttaaagaattcagagaag
gagtccaccgtcaacagcatctttcagatcatcaggagctgcagtcgaagtctggagaca
gaggaggaggacagctccagtgaagggaacagctctaggaaaaattccttgaaggataaa
gcccgatggcagtttataattggagatctgttggattctgaaaatgacatctttgagcag
ccccaagaatgggaccctcacgcatcagaagagccacagaaggcctttgaccatgggaca
gagctcatcccgtggtacgtgctgtccatccaagctgatgtgcaccagttcctgctgcag
ggggctacggtcatccactatgaccaggacatgcacctctctgcccgctgcttcctccag
cttcagcctgacaatagcaccttgacctggataaaacccaccactgcttccccagccagt
gctaaagcaaaacttggtgtgcttagtaacacatccgagcctggcaaattcccattactg
ggcaatgctggattaagtggcctggcagagggggtcttggatctgttttcagcaaaggct
gtgtacatgggacaccctagcattgatatacacactgtgtgtgtccagaacaaactgagt
aacatgtctctctcagagactggagtgacactgctctacgggcttcagaccacggacaat
aggttattgcactttgtggcaccaaagcacacagctaaaatgctcttcagtggattgttg
gaactcactagagctgtgagaaagatgaggaagttccctgaccaaagacagcagtggctg
cggaaacaatacgtcagcctttaccaggaggatggacgatatgaaggcccaactttggct
cacgctgtggagttgtttggcggcagacgatggagtactcgaaaccccagtcctgggaca
tcagcaaagagtgctgagaagcccaacgtgcagagaaacaacaccttgggtataagcacc
accaagaaaaagaagaaaatccttatgaggggtgagagtggagaggccaccgacgacgag
atggccacccgcaaagccaaaacacacaaagagtgtcggagtcggagtggttctgatcct
caagacgttaatgaacaagaagaatcagaggcgaacgccatcacaagccctcctaaccct
ctcccttccagaagagcccactctttgaccacggctgggtcccctaacttggctgccggg
acgtcatctcccatcaggccagtgtcctcccctgtgctgtcttcttcaaacaagagcccg
tccagtgcttggagcagcagcagctggcatgggcgcatcaaaggaggaatgaagggcttt
cagagcttcatggtttcagacagcagcatgagttttgtggagtttgttgaactgttcaaa
tcattcagtgtgaggagccgcaaggacctgaaggatctctttgacatctacgccgtaccc
tgcgaccgagccggctccgaggcggcccccctctacaccaacctgaccattgatgaaaac
accagcggtcttcagcctgacctagatttgctgaccagaaatgtctccgatttggggtta
ttcattaagagtaaacagcagctgtccgacaaccagaggcagatatctgatgccattgct
gctgcaagtatcgtgacaaatggcactggggtggagagcacatccctgggcgtatttgga
gttggcatcctccagctcaatgacttcctagtgaattgccaaggagaacactacacttac
gatgaaatcctcagcatcatccagaagttcgagcctagtatcagtatgtgtcatcagggc
ctaatgtcgtttgaaggatttgcaaggtttctgatggataaagataattttgcctcaaaa
aatgatgagtcgcaggagaacattaaagaattgcaattgcccctctcctactactacatt
gaatcttcacacaatacctacctcacaggccatcaactcaaaggagaatcctcagtagaa
ctctacagccaggtcctcctgcaaggctgtaggagtgtagagttggactgctgggacgga
gatgatgggatgcccatcatttatcatggacacaccctgacaaccaagatccccttcaag
gaagtggttgaagccatcgatcgcagtgcctttatcaactccgacctccccatcatcata
tcgattgagaaccactgttcattgcctcagcaacgaaaaatggcagaaattttcaagact
gtgtttggagaaaaactggtggctaaattcttatttgagagtgatttctcagatgatcca
atgcttccctcacctgaccaactcaggaggaaagtgcttctcaaaaataagaagttaaaa
gcccatcagacaccggtggatatattaaagcaaaaggctcatcagctagcgtccatgcaa
gctcaggcttataatggtggcagtgccaaccctccacctgctaataacgaagaagaggaa
gatgaagaggacgaatatgattatgactatgaatccctctctgacgcagatgtccttact
gcttctcctgctcctaacagtcaggaagacaacattctagaagacagacctgaaaataaa
tcatgtaatgacaaacttcagtttgagtataatgaagaaatccccaagaggataaagaaa
gcagataactctgcttgcaacaaaggaaaggtttatgacatggaactgggagaagaattt
tatcttcctcagaataaaaaggaaagcagacagattgcaccagagctttctgaccttgtc
atctattgccaagcagtaaagtttccaggcctgtcaactctaaatgcatctggctctagc
agaggaaaagaaaggaaaagcaggaagtccatttttggcaacaatccgggcagaatgagc
cccggggagacagcatcatttaacaaaacatctggaaaaaattcctgtgaaggaatgcga
caggcctgggaggactcgccttcctctgtcaacccaaccacgtccctcagcgcgatcatt
agaactcccaaatgctaccacatctcctcgctgaatgaaaatgccgccaaacgtctgtgt
cgcaggtattctcagaaactgatccagcacactgcctgccagctgctgaggacgtatccg
gctgccacccgcatcgactcatccaaccccagccccctcctcttctggctccatgggata
cagctcgtggcgctcaactaccagacagatgatctccctttacatttaaacgctgccatg
tttgaggccaacggtggctgtggttatgttctgaaacccccagttctgtgggacaagaac
tgtcccatgtatcagaagttttctcccttggaaagagacctggacaacatggagtctgcc
gtctattctttaactattgtctctgggcagaacgtgtgcccgagtaacagcacgggaagc
ccgtgtatagaggtcgacgtcctgggcatggccctggatagctgccacttccgcacgaag
cccatccaccgcaatactctgaaccccatgtggaatgaacagttcctcttccgggttcac
tttgaagatctcctatttcttcgttttgctgtcgtggagaacaacagctcggtggtaact
gctcagagaatcatccccctcaaggctctaaagcgaggatatcgacatcttcagctgcga
aacctccacaatgaagtcttggaaatctctagtttattcataaacagcaggaggatggaa
gaaaattcctctggcaatactatgccggcctctttgatgtttaatacagaagaaagaaaa
tgtttgcagattcacagagtcacagtacatggggtcccaggtccagagccctttgctgtt
ttctccataaatggaggcaccaaggcaaagcagcttctccaacaaagtctgaccattgat
caagacaccaaacctattgccacagactattttttaatggaagaaaaatattttatatct
aaagaaaagaatgaatgtaggaaacaaccgttccagagagccattggtccagaagaagag
atcatgcagattttaagcagctggtttccagaagagggatatgttggcaggattgtctta
aaaacccagcaggaaaacctggaagagaagagcatcgttcaagatgacaaggagatgatc
ttgagctcagaggaggagagtttctttgtccaagtgcatgacgtttctccagagcaaccg
cgaacggtcatcaaggcgccccgcatcagcaccgcacaggacgtcattcagcagacctta
tgcaaagccaaatattcctatagcatcttgagcaaccccaacccgggtgattatgtgctt
ttggaagaggtggtgaaagacactgccaacaggaagtcttctaccccaaagtcctcccag
cgtgtccttttggatcaggagtgtgtttttcaagctcaaagcaggtggaaaggtgcagga
aaattcatccttaagctaaaggaacaagtgcaggcatcccgagaagacaaaagaaaaggc
atctcttttgcaagcgaactcaagaagctcaccaagtcgactaaacagccccgaggactc
acgtcgtcttctcaggtcttggcctcagaaaatgtccaaaacaaggaggagaaacctgtg
ggcagcatgtcctccagtgacacgatagactatcgacagtga

DBGET integrated database retrieval system