KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103016623
Entry
103016623         CDS       T03086                                 

Gene name
TIAM1
Definition
(RefSeq) T-cell lymphoma invasion and metastasis 1
  KO
K05731  T-lymphoma invasion and metastasis-inducing protein 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04530  Tight junction
bacu04810  Regulation of actin cytoskeleton
bacu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103016623 (TIAM1)
   04015 Rap1 signaling pathway
    103016623 (TIAM1)
   04024 cAMP signaling pathway
    103016623 (TIAM1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103016623 (TIAM1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103016623 (TIAM1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    103016623 (TIAM1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103016623 (TIAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:bacu04990]
    103016623 (TIAM1)
Domain-containing proteins not elsewhere classified [BR:bacu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   103016623 (TIAM1)
SSDB
Motif
Pfam: RhoGEF Tiam_CC_Ex PH RBD PH_9 PDZ PDZ_6 PDZ_2 PH_11
Other DBs
NCBI-GeneID: 103016623
NCBI-ProteinID: XP_007183752
UniProt: A0A384A8V5
LinkDB
Position
Un
AA seq 1592 aa
MGNAESQNVVHEFYGEKHASLGRKHTSRSLRLSHKARRTRHASSGKVIHRTSEVTPRSSS
TPSIPQSLAENGLEPFSQEGTLEDFGSPIWVDRVDVGLRPVSYTDSSVSPSGGSSIVLAA
ASVQSMPDSEESRLYGHDATYLAEGGRRQHPYISNGPTFTETASFKKKRSKSADIWREDS
LEFSLSDLSQEHLTSNEEILGSAEEKDCEETRGMEAPASPRQLSTCQRANSLGDLYAPQK
TSGVTADGGRRSKFAGYCRNLVSDIPDLANHKMPPAAAEEALPYSNYNTLPCRKSHCLSE
GATNPQMSHNNSMQGRRAKTTQDVNAGEGSEFADSGIEGAATDTDLLSRRSNATNSSYSP
PTGRAFVGSDSGSSSTGDAARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTLSS
PGQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYES
DGRSGIDHNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWI
TAIHSACAAAVARHHHKEDTLQLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKT
ILDQIFVWEQNLEQFQMDLFRYRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSV
SSFHALVAARTGETGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPSINQVFGEG
TEAVKKSLQGIFDDTVPDGKREKEMVLPSVHQHNPDCDIWVHEYFTPSWFCLPNNKPVLT
VVRPGDTARDALELICKAHRLDHSAHYLRLKFLIENKMQHYVPKPEEDIYELLYKEIEIC
PKVTQNIQIEKSDTAGDNYGFSLSSVEEDGVRRLYVNSVKETGLASKKGLKAGDEILEIN
SRAAGTLNASVLKDFLAQLSLGLLVRTYPELEGGAELLGSPPLRLDGPADLSENPLAFLT
SNTGHSLCSQQGSSVETAPEETEGPDLESSDETDHSSKSTEQVAAFCRSLHEMNPSDPSP
SPQDSAGPQLATMRQLTDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQD
ELDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRF
KLYSAFCASHTKVPKVLVKAKMDAAFKAFLDAQNPKQQHSSTLESYLIKPIQRILKYPLL
LKELFALTDAESEEHYHLDLAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEV
ADLSMGDLLLHTTVIWPNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKRKLVGSHR
LSIYEDWDPFRFRHMIPTEALQVRALASADTEANAVCEIVHVKSESEGRPERVFHLCCSS
PESRKDFLKAVHSILRDKHRRQLLKTESLPSSQQYVPFGGKRLCALKGARPAMSRAVSAP
SKSLGRRRRRLARNRFTIDSDAISASSPEKESQQPPGGGDTDRWVEEQFDLARYEEQDDI
KETDILSDDDEFCESAKGATADRDLRERLQAACISQREGGQKPLHSHASRMTQLKKQAAL
SGINGGPESTSEEVIWVRREDFAPSRKLNTEI
NT seq 4779 nt   +upstreamnt  +downstreamnt
atgggaaacgcagaaagtcaaaatgtagtgcatgagttttatggagaaaagcatgcgagc
ctggggcgcaaacacacgtcgcgctccctgcgcctgtcgcacaaggcgcggcggaccagg
cacgcctcctcggggaaggtgatccacaggacctccgaagtgaccccccgatccagcagc
actcccagtatcccccagtccctggccgaaaatggcttggagcccttctcccaagaaggc
accctggaggacttcgggagccccatctgggtggaccgagtggatgtgggcttgagaccc
gtgtcttacacggattcttccgtcagtcccagcggaggcagcagcatcgtcctcgcagca
gcctctgtgcagagcatgccagactcggaggagagcaggctttacgggcatgacgctacg
tacttggcggagggaggcaggaggcagcatccctatatatccaatgggcccactttcacg
gagacggcgagctttaagaagaaacgctccaaatctgcagacatctggcgggaggacagc
ctggaattctcactctctgatctgagccaagaacatttaacaagcaacgaagagatcttg
ggttctgccgaagagaaagactgcgaggagactcgggggatggaagccccggcgagtccg
cggcagctcagtacctgtcaacgtgccaattcactgggggacttgtacgctcctcagaaa
acctccggggtgacggcagacggggggcggaggagcaaatttgcaggctactgtcggaat
ttggtgtctgatattcctgatctcgcgaaccataagatgccaccggctgctgccgaagag
gctcttccgtacagtaattataacacacttccctgtaggaaatctcactgtctttccgaa
ggtgccaccaacccacaaatgagccacaacaacagcatgcaaggcagaagagcaaaaaca
actcaggatgttaatgcgggcgagggtagcgagtttgccgacagtgggatcgaaggggcc
gccaccgacacggacctcctgtccaggcgatccaatgccaccaactccagctactcaccc
cccaccggccgcgcctttgtgggcagcgacagcggcagcagctccaccggggatgcagcc
cgccagggggtgtacgagaatttccgacgggagctggagatgagtaccaccaacagcgag
agcctggaggaggccggctcggcgcacagcgacgagcagagcagcggtaccctgagctcc
ccgggccagtcggacatcctgctcacggccgcgcagggcacagtgcgtaaggccggagcc
ctggcagtcaagaacttcctggtacacaagaagaacaagaaggtggagtcggccacccgg
aggaagtggaagcactactgggtgtccctgaaaggatgcacgctctttttctacgagagc
gatggcaggtctgggatagaccacaatagcatccccaagcatgccgtctgggtggagaac
agcatcgtgcaggccgtgcctgagcaccccaagaaggacttcgtcttctgcctcagcaat
tccctgggtgatgccttcctttttcagaccaccagccagacggagctggagaactggatc
actgccatccattctgcctgtgcagccgctgtcgcaagacaccatcacaaagaagacacg
ctccaactgctgaagtcggaaatcaaaaaactggaacagaagatagatatggacgaaaag
atgaagaaaatgggcgaaatgcagctgtcttcagtcactgattcaaagaagaagaaaact
atattagatcagatctttgtttgggagcagaatcttgaacagttccaaatggacctgttt
cgctaccgctgttatttagccagcctccaaggtggggagctgcccaaccctaaaagacta
cttgcctttgcaagccgtccaacgaaagtggcaatgggccgccttggaatcttttctgta
tcatcttttcatgcgctggtggccgctcgcactggtgaaactggagtcagaagacgtact
caggccatgtccagatctgccagcaagagaaggagcaggttttcttctctttggggtctg
gacactacctccaaaaagaagcagggacgcccaagcatcaatcaggtgttcggtgaggga
actgaggctgtaaagaaatctttacagggaatatttgatgacactgttccagatggcaag
agggagaaagaaatggtcttacccagcgtccaccagcacaaccctgactgtgacatttgg
gtccacgagtatttcactccgtcctggttctgtctgccaaataataagccagtcctgaca
gtcgtccggccaggggacacggcccgggacgccctggagctgatctgcaaggcacataga
ctggatcattctgctcattacctgcgcctgaaatttctaatagaaaacaaaatgcaacac
tacgtgccaaagcccgaggaggacatttatgagctgctgtacaaagaaattgaaatttgt
ccaaaagtcactcagaacatccagattgagaagtcagatacagccggtgataattatggc
ttttcactttcttctgtggaagaagatggtgttcgaaggctctacgtgaatagtgtaaag
gaaactggcttagcttccaagaaaggcctgaaagcgggagatgagattcttgagatcaat
agtcgtgccgcgggcaccctgaatgcctctgtgctcaaagatttcctcgcgcagctgtcc
ctgggcctcctggtgaggacctaccccgagctggagggaggagcagagctgctggggagc
ccgcctctccggctggacggccccgccgacctcagcgagaaccctctcgcctttctcacc
agcaacacagggcacagcctctgcagccagcagggcagtagcgttgagactgctccggag
gagaccgaggggccagacttggaatcctcagatgagactgatcacagcagcaagagcacg
gaacaggtggccgcgttttgccgcagtctgcacgagatgaacccctctgacccgagcccg
tccccccaggactctgccgggcctcagctggccaccatgagacagctcacggacgccgat
aagctgcgcaaggtcatctgtgagctcctggagacggagcgcacctatgtgaaagactta
aactgtctcatggagagatacctaaaacctcttcagaaagaaacttttctcacccaagat
gagcttgatgtgctctttggaaatttaactgaaatggtagagtttcaagtagaattcctt
aaaactctagaagatggagtgagattggtacctgatctggaaaagcttgagaaagttgat
caatttaagaaagtgctgttctctctggggggatcctttctgtattatgctgaccgcttc
aagctctacagtgccttctgtgccagccacacgaaggtccccaaagtcctggtgaaagcc
aagatggacgcagcgttcaaggcgttcctggatgcccagaacccgaagcagcagcactcg
tccactctggagtcttacctcatcaagcccatccagaggatcctcaagtacccgcttctg
ctgaaggagcttttcgctctgacggacgcggagagcgaggaacactaccacctggatttg
gccatcaagactatgaataaggttgcaagtcatatcaatgaaatgcagaaaatccatgaa
gaatttggggctgtgtttgaccagctgattgctgaacagactggtgagaaaaaagaggtt
gcagatctgagcatgggggacctgcttttgcataccactgtgatctggccaaacccgccg
gcctcgctgggaaagtggaaaaaggagcccgaattggcagcttttgtcttcaaaactgct
gtggtccttgtgtataaagatggttccaaacagaagaggaaacttgtaggatctcacaga
ctttcaatttacgaggactgggaccccttccgatttcgacacatgattcctaccgaagct
ttgcaggttcgagctttggcaagtgcagacacagaagcaaatgctgtgtgtgaaattgtc
cacgtaaaatcggagtctgaagggaggccggagagggtcttccacctgtgctgcagctcc
ccagagagcagaaaggatttcttgaaggctgtgcattccatcctgcgtgataagcacaga
agacagctcctgaagaccgaaagccttccctcgtcccagcaatatgtcccttttggagga
aaacgattgtgtgcgctgaaaggggccaggccagccatgagcagggcagtgtccgcccca
agcaagtctcttgggaggaggaggcggcgactggcccgaaacaggtttaccattgactct
gatgccatctccgccagcagcccggagaaggagtcccagcagccccccggtggcggggac
actgaccgctgggtagaggaacagtttgaccttgctcggtacgaggagcaggatgacatc
aaggagacggacatcctcagtgacgatgatgagttctgtgagtccgcgaagggcgccacc
gcggacagagacctgcgggagcggcttcaggccgcctgcatcagtcagcgggagggaggc
cagaagcccctgcatagtcacgcgtcccgcatgacgcagctcaagaagcaagccgccctg
tcgggcatcaacggaggcccggagagcacgagcgaggaggttatctgggttaggcgtgaa
gactttgccccctccaggaagctgaacactgagatctga

DBGET integrated database retrieval system