KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103016628
Entry
103016628         CDS       T03086                                 

Gene name
MMP9
Definition
(RefSeq) matrix metallopeptidase 9
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04657  IL-17 signaling pathway
bacu04668  TNF signaling pathway
bacu04670  Leukocyte transendothelial migration
bacu04915  Estrogen signaling pathway
bacu04926  Relaxin signaling pathway
bacu05161  Hepatitis B
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05215  Prostate cancer
bacu05219  Bladder cancer
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103016628 (MMP9)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    103016628 (MMP9)
   04670 Leukocyte transendothelial migration
    103016628 (MMP9)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103016628 (MMP9)
   04926 Relaxin signaling pathway
    103016628 (MMP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103016628 (MMP9)
   05202 Transcriptional misregulation in cancer
    103016628 (MMP9)
   05206 MicroRNAs in cancer
    103016628 (MMP9)
   05205 Proteoglycans in cancer
    103016628 (MMP9)
  09162 Cancer: specific types
   05219 Bladder cancer
    103016628 (MMP9)
   05215 Prostate cancer
    103016628 (MMP9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103016628 (MMP9)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103016628 (MMP9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103016628 (MMP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bacu01002]
    103016628 (MMP9)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     103016628 (MMP9)
Peptidases and inhibitors [BR:bacu01002]
 Metallo peptidases
  Family M10
   103016628 (MMP9)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 PT DUF4953 Reprolysin_4 Reprolysin_3 Peptidase_M66
Other DBs
NCBI-GeneID: 103016628
NCBI-ProteinID: XP_007185435
UniProt: A0A384ADM2
LinkDB
Position
Un
AA seq 706 aa
MNPWQPLVLALLVLGCSAAPRPRQPTFVVFPGELQSDLTDRQLAEEYLYRYGYTHVAEIS
EDDQSLRRPLQRLQRRLALPETGELDSTTLNAMRAPRCGVPDLGRFQTFEGDLKWHHHNI
TYWIQNYSEDLPRSVIDDAFARAFALWSAVTPLTFTRVYGREADIVIQFGVREHGDGYPF
DGKNGLLAHAFPPGPGIQGDAHFDDEELWSLGKGVVVPTYFGNAKGATCHFPFTFEGLSY
SACTTDGRSDDMLWCSTTADYDTDRQFGFCPSERLYTQDGNADGKPCVFPFTFEGRSYSA
CTTDGRSDGYRWCATTASYDQDKLYGFCPTRVDATVTEGNSAGELCVFPFIFLGKEYSAC
TREGRRDGQLWCATTSNFDRDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYP
MYSFTEKHPLHKDDVQGIQHLYGPHPEPEPRPPTXXXXXXXAPPTVCATWPPTAPPSERP
TAGSTGPPSAGPTGPPTAGPSAIPTRSLDPADDVCNVNIFDAIAEIGNRLYLFKDGRYWR
LSESGGRRLQGPFLIKNTWPALPRKLDSAFEDPLTKKIFFFSGRQVWVYTGASVLGPRRL
NKLGLGPEVAQVTGALPRAGGXXXXXSRQSFWRFDVKTQKVDPRSATPVDQMFPGVPIST
HDIFQYQEKAYFCQDRFYWRVSSRNEVNQVDYVGYVTFDLLHCPED
NT seq 2121 nt   +upstreamnt  +downstreamnt
atgaacccctggcagcccttggtcctggcgctcctggtgctgggctgctctgctgccccc
agaccacgccagcccacctttgtggtcttcccgggagaactacaaagcgatctcaccgac
aggcagctggcagaggaatatctgtaccgctacggctacactcatgtggcagagataagc
gaggatgatcagtccctgcgtcggcctctgcagcgtctccagcggcgcctggccctgccg
gagactggcgagctggacagcaccaccctgaatgccatgcgtgccccgcgctgcggcgtc
ccagacctgggcagattccagacctttgagggtgacctcaagtggcaccatcacaacatc
acctactggatccaaaactactcggaagacttgccgcgctccgtgatcgacgacgccttt
gcccgtgctttcgcgctctggagcgcggtgacgccgctcaccttcactcgcgtgtacggc
cgtgaagccgacatagtcatccagtttggtgttagggagcacggagatgggtatcccttc
gatggaaagaacgggctcctggcacacgcctttcctcctggcccaggcattcagggagac
gcccacttcgacgatgaagagttatggtctctgggcaaaggcgtcgtggttccgacctac
ttcggaaacgcaaagggcgccacctgccacttccccttcaccttcgagggcctctcctac
tccgcctgcaccacggacggccgctccgacgacatgctctggtgcagcaccacggccgac
tacgacaccgaccgccagttcggcttctgccccagcgagagactctacacccaggacggc
aatgcggacggcaagccctgcgtttttccgttcacctttgagggccgctcctactccgcc
tgtaccaccgacggtcgctcggacggctaccgctggtgcgccaccaccgccagctatgac
caggacaagctctatggcttctgcccgacccgagttgacgcgacggtgaccgagggcaac
tcggcgggggagctgtgcgtcttccccttcatcttcctgggcaaggaatactcggcctgc
accagagagggccgccgtgatgggcagctctggtgcgccaccacctccaacttcgacaga
gacaagaagtggggcttctgcccggatcaaggatacagcctgttccttgtggcagcgcac
gagtttggccacgcgctgggcttagatcactcgtctgtgccagaggcgctcatgtacccc
atgtacagtttcactgagaagcaccccctgcataaggacgatgtgcagggcatccagcat
ctgtatggtcctcaccccgaacctgaaccacggcctccaacnnnnnnnnnnnnnnnnnnn
nnngcccctcccacggtctgcgccacgtggcctcccactgcccccccctcagaacgcccc
actgctggctccacaggccccccttccgctggccccacgggtcctcccactgctggccct
tctgcgatccctacaaggtccctggatccagcggacgatgtctgcaacgtgaacatcttc
gacgccatcgcggagatcgggaatcgcctgtatctcttcaaggatgggaggtactggcga
ctctctgagagcgggggacgccggttgcagggtcctttccttatcaagaacacgtggcct
gcgctgccccgcaagctggactccgcttttgaggatccgctcacgaagaagattttcttc
ttctctgggcgccaagtgtgggtgtacacaggcgcgtcggtgctaggcccaaggcgtctg
aacaagctgggcctgggcccggaagtggcccaagtcaccggggccctgccgcgcgccggg
ggnnnnnnnnnnnnnnnnagcaggcagagcttctggaggttcgacgtgaagacacagaag
gtggatccccggagcgccaccccagtggaccagatgttccccggggtgcccataagtact
cacgacatctttcagtaccaagagaaagcttacttctgccaggatcgcttctactggcgc
gtgagttcccggaatgaggtgaatcaggtggactatgtgggctacgtgacctttgacctc
ctgcactgccccgaggactag

DBGET integrated database retrieval system