KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103016933
Entry
103016933         CDS       T03086                                 

Gene name
MYC
Definition
(RefSeq) v-myc avian myelocytomatosis viral oncogene homolog
  KO
K04377  Myc proto-oncogene protein
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04110  Cell cycle
bacu04151  PI3K-Akt signaling pathway
bacu04218  Cellular senescence
bacu04310  Wnt signaling pathway
bacu04350  TGF-beta signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04630  JAK-STAT signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu05132  Salmonella infection
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
bacu05213  Endometrial cancer
bacu05216  Thyroid cancer
bacu05219  Bladder cancer
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05222  Small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103016933 (MYC)
   04012 ErbB signaling pathway
    103016933 (MYC)
   04310 Wnt signaling pathway
    103016933 (MYC)
   04350 TGF-beta signaling pathway
    103016933 (MYC)
   04390 Hippo signaling pathway
    103016933 (MYC)
   04630 JAK-STAT signaling pathway
    103016933 (MYC)
   04151 PI3K-Akt signaling pathway
    103016933 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103016933 (MYC)
   04218 Cellular senescence
    103016933 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103016933 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103016933 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103016933 (MYC)
   05202 Transcriptional misregulation in cancer
    103016933 (MYC)
   05206 MicroRNAs in cancer
    103016933 (MYC)
   05205 Proteoglycans in cancer
    103016933 (MYC)
   05230 Central carbon metabolism in cancer
    103016933 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103016933 (MYC)
   05225 Hepatocellular carcinoma
    103016933 (MYC)
   05226 Gastric cancer
    103016933 (MYC)
   05216 Thyroid cancer
    103016933 (MYC)
   05221 Acute myeloid leukemia
    103016933 (MYC)
   05220 Chronic myeloid leukemia
    103016933 (MYC)
   05219 Bladder cancer
    103016933 (MYC)
   05213 Endometrial cancer
    103016933 (MYC)
   05224 Breast cancer
    103016933 (MYC)
   05222 Small cell lung cancer
    103016933 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103016933 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103016933 (MYC)
   05161 Hepatitis B
    103016933 (MYC)
   05160 Hepatitis C
    103016933 (MYC)
   05163 Human cytomegalovirus infection
    103016933 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103016933 (MYC)
   05169 Epstein-Barr virus infection
    103016933 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103016933 (MYC)
   03019 Messenger RNA biogenesis [BR:bacu03019]
    103016933 (MYC)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    103016933 (MYC)
Messenger RNA biogenesis [BR:bacu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     103016933 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 103016933
NCBI-ProteinID: XP_007188950
UniProt: A0A384ANN3
LinkDB
Position
Un
AA seq 438 aa
MPLNVSFANRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIXKKFELLPTPP
LSPSRRSGLCSPSYVTVASFSPRGDDGGGGGSFSSADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAQKHGAGGSPARGHGGCSTSSLYLQDL
SAAASECIDPSVVFPYPLNDSSSPKPCASPDSTAFSPSSDSLLSSAASSPRASPEPLALH
EETPPTTSSDSEEEQEDEEEIDVVSVEKRQPPAKRSESGSPSAGGHSKPPHSPLVLKRCH
VSTHQHNYAAPPSTRKDCPAAKRAKLDSGRVLKQISNNRKCASPRSSDTEENDKRRTHNV
LERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEKDELR
KRREQLKLKLEQLRNSCA
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgcccctcaacgtcagcttcgccaacaggaactatgacctcgactacgactcggtgcaa
ccttatttctactgcgacgaggaggagaacttctaccagcagcagcagcagagcgagctg
cagccgcctgcgcccagcgaggatatctagaagaaatttgagctgctgcccaccccgccc
ctgtccccgagccgccgctccgggctctgctcgccctcgtacgtcacggtcgcgtccttc
tcccccaggggagacgacggcggcggcggcggcagcttctcctcggcggaccagctggag
atggtgaccgagctgctgggaggagacatggtgaaccagagcttcatctgcgaccccgac
gatgagaccttcatcaaaaatatcatcatccaggactgtatgtggagcggcttctcggcc
gccgccaagctcgtctcggagaagctggcctcttaccaggctcaaaagcacggcgccggc
gggagccccgcccgcgggcacggcggctgctccacctccagcttgtacctgcaggacctg
agcgccgccgcctccgaatgcatcgacccctccgtggtcttcccctacccgctcaacgac
agcagctcgcccaagccctgcgcctcccccgactccaccgccttctccccgtcctcggac
tctctgctctcctccgccgcgtcctccccgcgggccagtcccgagcccctggcgctccac
gaggagacaccacccaccaccagcagcgactctgaggaagaacaagaggatgaggaagaa
attgatgttgtttctgtggaaaagaggcagccccctgccaaaaggtcagaatcggggtca
ccctctgccggaggccacagcaaacctcctcacagcccgctggtccttaagagatgccat
gtgtccacccatcagcacaattatgcagcgcccccctccactaggaaggactgtcccgcc
gccaagagggctaagttggacagtggcagggtcctgaaacagatcagcaacaatcgcaaa
tgtgccagccccaggtcttcggacaccgaggagaatgacaagaggcggacacacaacgtc
ttggaacgccagaggagaaacgagctgaaacgcagcttttttgcccttcgtgaccagatc
ccggagttagaaaacaatgaaaaggcccccaaggtagttatccttaaaaaagccacagca
tacatcctgtccgtccaagcagaggagcaaaagctcatttcagaaaaagacgagttgcgg
aagaggcgagaacagttgaaactcaaacttgaacagctacggaactcttgcgcataa

DBGET integrated database retrieval system