KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017029
Entry
103017029         CDS       T03086                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04144  Endocytosis
bacu04151  PI3K-Akt signaling pathway
bacu04510  Focal adhesion
bacu04520  Adherens junction
bacu04540  Gap junction
bacu04630  JAK-STAT signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu04912  GnRH signaling pathway
bacu04915  Estrogen signaling pathway
bacu04921  Oxytocin signaling pathway
bacu04926  Relaxin signaling pathway
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04934  Cushing syndrome
bacu05160  Hepatitis C
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05218  Melanoma
bacu05219  Bladder cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05230  Central carbon metabolism in cancer
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103017029 (EGFR)
   04012 ErbB signaling pathway
    103017029 (EGFR)
   04014 Ras signaling pathway
    103017029 (EGFR)
   04015 Rap1 signaling pathway
    103017029 (EGFR)
   04630 JAK-STAT signaling pathway
    103017029 (EGFR)
   04066 HIF-1 signaling pathway
    103017029 (EGFR)
   04068 FoxO signaling pathway
    103017029 (EGFR)
   04020 Calcium signaling pathway
    103017029 (EGFR)
   04072 Phospholipase D signaling pathway
    103017029 (EGFR)
   04151 PI3K-Akt signaling pathway
    103017029 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103017029 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103017029 (EGFR)
   04520 Adherens junction
    103017029 (EGFR)
   04540 Gap junction
    103017029 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103017029 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103017029 (EGFR)
   04915 Estrogen signaling pathway
    103017029 (EGFR)
   04921 Oxytocin signaling pathway
    103017029 (EGFR)
   04926 Relaxin signaling pathway
    103017029 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    103017029 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103017029 (EGFR)
   05206 MicroRNAs in cancer
    103017029 (EGFR)
   05205 Proteoglycans in cancer
    103017029 (EGFR)
   05230 Central carbon metabolism in cancer
    103017029 (EGFR)
   05231 Choline metabolism in cancer
    103017029 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103017029 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103017029 (EGFR)
   05212 Pancreatic cancer
    103017029 (EGFR)
   05225 Hepatocellular carcinoma
    103017029 (EGFR)
   05226 Gastric cancer
    103017029 (EGFR)
   05214 Glioma
    103017029 (EGFR)
   05218 Melanoma
    103017029 (EGFR)
   05219 Bladder cancer
    103017029 (EGFR)
   05215 Prostate cancer
    103017029 (EGFR)
   05213 Endometrial cancer
    103017029 (EGFR)
   05224 Breast cancer
    103017029 (EGFR)
   05223 Non-small cell lung cancer
    103017029 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103017029 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    103017029 (EGFR)
   05171 Coronavirus disease - COVID-19
    103017029 (EGFR)
   05163 Human cytomegalovirus infection
    103017029 (EGFR)
   05165 Human papillomavirus infection
    103017029 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103017029 (EGFR)
   01522 Endocrine resistance
    103017029 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103017029 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacu04147]
    103017029 (EGFR)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103017029 (EGFR)
Protein kinases [BR:bacu01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   103017029 (EGFR)
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   103017029 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   103017029 (EGFR)
  Exosomal proteins of bladder cancer cells
   103017029 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like Borrelia_P83 Kdo
Other DBs
NCBI-GeneID: 103017029
NCBI-ProteinID: XP_007187724
UniProt: A0A384AKI5
LinkDB
Position
Un
AA seq 1156 aa
MFNNCEVVLGNLEITYMQSSYNLSFLKTIQEVAGYVLIALNTVEKIPLEKLQIIRGNVLY
ENTHALAVLSNYGANKTGLRELPMRNLQEILQGAVRFSNNPVLCNMETVQWRDIVHADFL
SNMSIEFQNQLSKCPKCDPVCLNGSCWGAGKENCQKMTKVICAQQCSGRCRGRSPSDCCH
SQCAAGCTGPRESDCLVCRRFRDEATCKDTCPPLMLYDPTTYEMKVNPLGKYSFGATCVR
KCPRNYVVTDHGSCVRACSSDSQEVEEDGVRKCKKCDGPCGKVCNGIGIGEFKDTLSINA
TNIKHFRNCTSISGDLHILPVAFRGDSFTRTPPLDPKELDILKTVKEITGFLLIQAWPAN
RTGLHAFENLEIIRGRTKQHGQFSLAVVGLDIMSLGLRSLKEISDGDVIISGNRKLCYAD
TINWKKLFGTSNQKTKIINNRSEKECKATGHVCNPLCSSEGCWGPKPKDCVSCRNFSRGK
ECVEKCNILKGEPREFVENSECVQCHPECLPQAMNVTCTGHGPGSCVKCAHNIDGPHCVK
TCPAGVTGENSTLIWKYADANHMCHLCHPSCTYGCAGPGLQGCAVNGPRIPSIATGIVGA
LLLALVLALGVGLFLRRRRIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETELK
KVKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPH
VCRLLGICLTSTVQLVTQLMPFGCLLDYVREHKDNIGSQHLLNWCVQIAKGMNYLEDRRL
VHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTH
QSDVWSYGVTVWELMTFGSKPYDGIPASEISTVLEKGERLPQPPICTIDVYMIMVKCWMI
DADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRTLMDEEDMEDVVDA
DEYLIPQQGFFHSPTTSRTPLLSSLSATSSTPTVACVDRNGQSYPLKEDSFLQRYSSDPT
GTLTEDSIDDAFLPAAEYINQSIPKRPAGSVQNPVYHNQPLNPAPGRDPHYQNSHSNAVG
NPEYLNTAHPACASGVLDGPALWAQKGGHQINLDNPDYQQAFLPKDAKSNGIFKGPAAEN
AEYLRAAPAGSDLTGA
NT seq 3471 nt   +upstreamnt  +downstreamnt
atgttcaataactgtgaggtggtccttgggaatttggaaattacctacatgcaaagtagt
tacaacctttctttcctaaagaccatccaggaggttgctggctatgtactcattgccctc
aacacagtggagaagattcctttggaaaagctgcagatcatcagaggaaatgtgctctat
gaaaacacccatgccttagcggtcttatccaactacggtgcaaataaaaccggactgagg
gagttgcccatgagaaacttacaggagatcctgcaaggtgctgtgcgattcagcaacaac
cccgtgctctgcaacatggagaccgtccagtggagggacatcgtccacgccgactttcta
agcaatatgtcgattgaatttcagaaccagctgagcaaatgcccaaagtgtgatccagtc
tgtcttaatggaagctgctggggtgcggggaaggagaactgccagaaaatgaccaaagtc
atctgtgcccagcagtgttccgggcgctgccgcggcaggtcccccagcgactgctgtcac
agccagtgtgccgccggctgcacggggccgcgggagagcgactgcctggtctgccgcagg
ttccgggacgaagccacgtgcaaggacacatgcccgccactcatgctgtacgaccccacc
acctacgagatgaaagtcaacccgctggggaagtacagcttcggcgccacctgtgtcagg
aagtgcccccgtaactacgtggtgacggaccacggctcgtgcgtccgcgcctgcagctcg
gacagccaggaggtggaggaggacggcgtccgcaagtgcaaaaagtgcgacggaccttgt
ggcaaagtttgtaacggaataggaattggtgagttcaaagatacactttccataaatgct
acaaatattaaacacttcagaaactgtacctcgatcagtggagaccttcatatcctgcca
gtagcatttaggggtgattccttcacacgtactccacctctggacccaaaggaactggac
attctaaaaactgtaaaggaaataacagggtttttgctgattcaggcctggcctgcaaac
aggactggcctccatgcttttgagaacctggaaatcatacgtggcaggacgaagcaacat
ggtcagttttctcttgcggttgttggcctggatataatgtccttgggattacgctccctc
aaggagataagtgatggagatgtgatcatttcaggaaaccgaaagttgtgctacgcagat
acaataaactggaaaaaactctttgggacctcaaatcagaaaaccaaaattataaacaac
aggagtgaaaaagagtgcaaggccacgggccacgtctgtaacccgctgtgctcgtcagag
ggctgctggggcccgaaacccaaagactgcgtgtcttgccgaaacttcagccgtggcaag
gagtgtgtggagaagtgcaacattctaaagggagagcccagggagttcgttgagaactcc
gagtgcgtgcagtgccatccggaatgcctgccccaggccatgaacgtgacctgcacggga
cacggaccaggcagctgtgtaaagtgtgcccacaacatcgacggccctcactgcgtcaag
acctgccctgctggagtcacaggagaaaacagcaccctgatctggaagtatgcagatgcc
aatcacatgtgtcacctgtgccaccccagctgcacctacggctgtgctgggccaggtctt
caaggctgtgcagtgaatgggcccaggattccgtccatcgccaccgggatcgtgggcgcc
ctgctgctggcgctggtgctggccctgggcgtcggcctcttcctgcgcaggcgccgcatc
gtccgcaagcgcacgctgcgccggctgctgcaggagcgcgagcttgtcgagcctctgacg
cccagcggagaagctcccaaccaagctctcttgaggatcttaaaggagacggaattaaaa
aaggtcaaggtgctgggctccggagcattcggcacggtgtacaagggactctggatccca
gaaggcgagaaggttaaaattcctgtggctatcaaggaattaagagaagccacatctcca
aaagccaacaaggaaattcttgatgaagcctacgtgatggccagtgtggacaaccctcac
gtgtgccgcctcctgggcatctgcctgacgtccacggtgcagctcgtcacgcagctcatg
cccttcggctgcctgctggattatgtccgtgaacacaaggacaacatcggctcccagcac
ctgctcaactggtgcgtgcagatcgcaaagggcatgaactacctggaagaccggcgcttg
gtgcaccgagacctggcggccaggaatgtgctggtgaagacgccgcagcacgtcaagatc
acggatttcgggctggccaaactgctgggcgccgaggagaaggagtaccacgcagaaggg
ggcaaagtgcctatcaagtggatggccttggaatcaattttacaccgaatttacacccac
cagagtgatgtctggagctacggagtcaccgtttgggagttgatgacctttgggtccaag
ccttacgacgggatccccgcgagtgagatctcaaccgtcctggagaagggagagcgcctg
cctcagccacccatctgcaccatcgacgtctacatgatcatggtcaagtgctggatgatt
gatgcagatagtcgcccaaagttccgtgagttgatcattgaattctccaaaatggcccga
gacccccagcgctaccttgtcatccagggggacgagaggatgcatttgccaagccctacg
gactccaacttctaccgcaccctgatggacgaagaggacatggaggatgtcgtggacgcc
gatgagtacctcatcccccagcagggcttcttccacagccccaccacttcccggacgccc
ctcctcagttccctgagcgccaccagcagcactcccactgtggcttgcgttgatagaaac
gggcagagctatcccctcaaggaagacagcttcttgcagcggtacagctcagaccccact
ggcaccttgaccgaggacagcatcgatgacgccttccttccggcggccgaatacataaac
cagtcgattcccaaaaggcccgcgggctctgtccagaaccccgtctatcacaatcagcct
ctaaacccggctccaggcagagaccctcactaccagaattcccacagcaatgccgtgggc
aaccctgagtatctcaacaccgcccaccccgcctgcgccagcggtgtgctcgacggccct
gccctctgggcgcagaaaggcggtcaccagattaacctggacaaccctgactaccagcag
gccttccttcccaaggacgccaagtcaaacggcatctttaagggtcccgccgctgaaaat
gcggaatacctgagggcagcgccagcaggcagtgaccttaccggggcctga

DBGET integrated database retrieval system