KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017288Help
Entry
103017288         CDS       T03086                                 

Gene name
AOC1
Definition
(RefSeq) amine oxidase, copper containing 1
  KO
K11182  diamine oxidase [EC:1.4.3.22]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00330  Arginine and proline metabolism
bacu00340  Histidine metabolism
bacu00380  Tryptophan metabolism
bacu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    103017288 (AOC1)
   00340 Histidine metabolism
    103017288 (AOC1)
   00380 Tryptophan metabolism
    103017288 (AOC1)
Enzymes [BR:bacu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.22  diamine oxidase
     103017288 (AOC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN2 Cu_amine_oxidN3 DUF1965
Motif
Other DBs
NCBI-GeneID: 103017288
NCBI-ProteinID: XP_007165448
UniProt: A0A383YRF9
LinkDB All DBs
Position
Un
AA seq 755 aa AA seqDB search
MGRKTLALGWAGAAILVLQTLAAAEGFPRTPGNKGRVFADLSAQELKTVHSFLWAQKELR
LQPSSTLTMAKNSVFLIEMLLPKKQHVLKFLHKGHQLPVREARAVIFFGAQEHPNITEFA
VGPLPRPHYMRHLPHKPGHQASWASRPISKAEYTLLSHTLEEASKPLQQFFRRTTGFTFG
HCHERCLTFTDVAPRGLASGQRRSWFILQRHMKGYFLHPTGLELLVDHASTNPQDWTVEQ
VWYNGKFYRSPAELAQKYDDGEVDAVVLEDPLAKDKDGESLPEAALFSFYQPRGDFSITM
HGPRLVQPKGPRYSLEGNTVLYGGWSFTFRLRSSSGLQVLDVHFGGERIAYEVSVQEAVA
LYGGHTPAGMQTKYMDVGWGLGSVTHELAPGVDCPETATFLDALHYYDADGPVLYPRALC
LFEMPTGVPIRRHFNSNFSDGFNFYAGLKGQVLVLRTTSTVYNYDYIWDFIFYPNGVMEA
KMHATGYVHATFYTPEGLRHGTRLHTHLIGNMHTHLVHYRVDLDVAGTKNSFQTLQMKLE
NTTNPWSPRHRLVQPALQETRYSRERQAAFSFRQTLPKYLLFTSPQENPWGHKRSYRLQI
HSMADQVLPPGWQEEQAVTWARYPLAVTRYRESELRSSSIYNQNDPWDPPVVFEEFLRNN
ENIEGKDLVAWVTVGFLHIPHAEDIPNTATPGNSVGFLLRPFNFFPEDPSLASRDLVVVW
PLENGSTYVQHWIPEEEGGCLMPPPFSYNGTYRPV
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atggggcggaagaccctggccctcggctgggcgggtgctgccatcctggtgctacagacg
ttggccgcggcagagggcttcccacggacccccggcaacaagggcagggtgtttgcggac
ctgagcgcccaagagctgaagaccgtgcacagcttcctttgggcccagaaggagctgagg
ctgcagccgtccagcacattgaccatggccaagaactccgtgttcctcattgagatgttg
ctgcccaagaagcaacacgtgctgaaatttctgcacaaaggccaccagcttcccgttcgg
gaagcgcgcgctgtcatcttcttcggagcccaggagcatcccaacatcaccgagtttgct
gtgggaccactgcccaggccccattacatgcgacacctgccccacaagcccgggcaccag
gcctcctgggcctccaggcccatctccaaggcagagtatactctcctgagccacaccctg
gaggaggccagcaagcccctgcagcagtttttccgtcgcaccacgggcttcacgttcgga
cactgccacgagcgctgcctgacgttcacagacgtggcgccccgtggcttggcctccggc
cagcgccgctcttggtttatcttgcagcgccatatgaaaggctacttcttgcaccccact
gggctggagctcctggtggatcatgcaagcacgaacccccaagactggacggtggagcag
gtctggtacaacgggaagttctaccgcagccccgcagagctggctcagaagtatgacgac
ggagaggtggatgcggtagtcctggaagacccgctcgccaaggacaaggatggagagagc
ctaccagaggcagccctcttctccttctaccagccacgtggggacttctccatcaccatg
cacggcccccgcctggtgcagcccaagggcccccgctacagcctggagggcaacaccgtg
ctctacgggggctggagcttcaccttccggctgcgctcgtcctcggggctgcaggtcctg
gacgtgcacttcggaggtgagcgtatagcctacgaggtgagcgtgcaggaggccgtggcg
ctgtacggaggacacacacccgcaggcatgcagaccaagtacatggacgtcggctggggc
ttgggcagcgtcactcatgagctggcccctggcgtcgactgcccggagacggccaccttc
ctggatgccctccactactacgacgccgacggtcctgtcctctacccccgcgccctctgt
ctcttcgagatgcccacgggggtgcccatccggcggcactttaactccaacttcagcgat
ggcttcaacttctatgcgggcctcaagggccaggtgctggtgctgaggaccacttcgacg
gtctacaattatgactatatctgggacttcatcttctaccccaatggggtgatggaggcc
aagatgcacgccaccggctatgtccacgccaccttctacacccccgaggggctgcgccat
gggacccgcctgcacacacacctgatcggcaacatgcacacccacctagtgcattaccgc
gttgacctggacgtggcaggcaccaagaatagcttccagaccctgcagatgaagctggaa
aacaccaccaacccctggagcccgagacaccgcctggtccagccggctctccaggagacg
aggtactcccgggagcgccaggcggccttcagcttcaggcagactctgcccaagtacctg
ctgtttaccagcccccaggagaacccctggggccacaagcgcagctaccgactgcagatc
cactccatggctgaccaagtgctgcccccgggctggcaggaggagcaggctgtcacctgg
gccaggtatcccctggcagtgaccagataccgggagtctgagctacgcagcagcagcatc
tacaaccagaacgacccctgggacccacctgtggtctttgaggagtttctgcgcaacaac
gagaacattgaaggcaaggacctggtggcctgggtcacagtgggcttcctgcacatcccc
cacgcagaggacatccccaacacggccacacccgggaactccgtgggcttcctgctccgg
cccttcaacttcttcccagaggacccgtccctggcgtccagagacctcgtggtcgtgtgg
cctctggaaaatggctccacctatgtgcagcactggatccctgaggaggaggggggctgc
ttgatgcctccccctttcagctacaatggaacctacaggcctgtgtga

DBGET integrated database retrieval system