KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017381
Entry
103017381         CDS       T03086                                 

Gene name
MAP2K1
Definition
(RefSeq) mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04071  Sphingolipid signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04114  Oocyte meiosis
bacu04140  Autophagy - animal
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04210  Apoptosis
bacu04218  Cellular senescence
bacu04270  Vascular smooth muscle contraction
bacu04370  VEGF signaling pathway
bacu04371  Apelin signaling pathway
bacu04380  Osteoclast differentiation
bacu04510  Focal adhesion
bacu04540  Gap junction
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04613  Neutrophil extracellular trap formation
bacu04620  Toll-like receptor signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04668  TNF signaling pathway
bacu04720  Long-term potentiation
bacu04722  Neurotrophin signaling pathway
bacu04725  Cholinergic synapse
bacu04726  Serotonergic synapse
bacu04730  Long-term depression
bacu04810  Regulation of actin cytoskeleton
bacu04910  Insulin signaling pathway
bacu04912  GnRH signaling pathway
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04917  Prolactin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu04921  Oxytocin signaling pathway
bacu04926  Relaxin signaling pathway
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04929  GnRH secretion
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05034  Alcoholism
bacu05132  Salmonella infection
bacu05135  Yersinia infection
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05216  Thyroid cancer
bacu05218  Melanoma
bacu05219  Bladder cancer
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05230  Central carbon metabolism in cancer
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103017381 (MAP2K1)
   04012 ErbB signaling pathway
    103017381 (MAP2K1)
   04014 Ras signaling pathway
    103017381 (MAP2K1)
   04015 Rap1 signaling pathway
    103017381 (MAP2K1)
   04370 VEGF signaling pathway
    103017381 (MAP2K1)
   04371 Apelin signaling pathway
    103017381 (MAP2K1)
   04668 TNF signaling pathway
    103017381 (MAP2K1)
   04066 HIF-1 signaling pathway
    103017381 (MAP2K1)
   04068 FoxO signaling pathway
    103017381 (MAP2K1)
   04072 Phospholipase D signaling pathway
    103017381 (MAP2K1)
   04071 Sphingolipid signaling pathway
    103017381 (MAP2K1)
   04024 cAMP signaling pathway
    103017381 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    103017381 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    103017381 (MAP2K1)
   04150 mTOR signaling pathway
    103017381 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103017381 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103017381 (MAP2K1)
   04210 Apoptosis
    103017381 (MAP2K1)
   04218 Cellular senescence
    103017381 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103017381 (MAP2K1)
   04540 Gap junction
    103017381 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103017381 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103017381 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103017381 (MAP2K1)
   04620 Toll-like receptor signaling pathway
    103017381 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    103017381 (MAP2K1)
   04660 T cell receptor signaling pathway
    103017381 (MAP2K1)
   04662 B cell receptor signaling pathway
    103017381 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    103017381 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    103017381 (MAP2K1)
   04062 Chemokine signaling pathway
    103017381 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103017381 (MAP2K1)
   04929 GnRH secretion
    103017381 (MAP2K1)
   04912 GnRH signaling pathway
    103017381 (MAP2K1)
   04915 Estrogen signaling pathway
    103017381 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    103017381 (MAP2K1)
   04917 Prolactin signaling pathway
    103017381 (MAP2K1)
   04921 Oxytocin signaling pathway
    103017381 (MAP2K1)
   04926 Relaxin signaling pathway
    103017381 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    103017381 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    103017381 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    103017381 (MAP2K1)
   04916 Melanogenesis
    103017381 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103017381 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    103017381 (MAP2K1)
   04726 Serotonergic synapse
    103017381 (MAP2K1)
   04720 Long-term potentiation
    103017381 (MAP2K1)
   04730 Long-term depression
    103017381 (MAP2K1)
   04722 Neurotrophin signaling pathway
    103017381 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103017381 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103017381 (MAP2K1)
   05206 MicroRNAs in cancer
    103017381 (MAP2K1)
   05205 Proteoglycans in cancer
    103017381 (MAP2K1)
   05230 Central carbon metabolism in cancer
    103017381 (MAP2K1)
   05231 Choline metabolism in cancer
    103017381 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103017381 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103017381 (MAP2K1)
   05212 Pancreatic cancer
    103017381 (MAP2K1)
   05225 Hepatocellular carcinoma
    103017381 (MAP2K1)
   05226 Gastric cancer
    103017381 (MAP2K1)
   05214 Glioma
    103017381 (MAP2K1)
   05216 Thyroid cancer
    103017381 (MAP2K1)
   05221 Acute myeloid leukemia
    103017381 (MAP2K1)
   05220 Chronic myeloid leukemia
    103017381 (MAP2K1)
   05218 Melanoma
    103017381 (MAP2K1)
   05211 Renal cell carcinoma
    103017381 (MAP2K1)
   05219 Bladder cancer
    103017381 (MAP2K1)
   05215 Prostate cancer
    103017381 (MAP2K1)
   05213 Endometrial cancer
    103017381 (MAP2K1)
   05224 Breast cancer
    103017381 (MAP2K1)
   05223 Non-small cell lung cancer
    103017381 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103017381 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    103017381 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    103017381 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103017381 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103017381 (MAP2K1)
   05135 Yersinia infection
    103017381 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103017381 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    103017381 (MAP2K1)
   05161 Hepatitis B
    103017381 (MAP2K1)
   05160 Hepatitis C
    103017381 (MAP2K1)
   05164 Influenza A
    103017381 (MAP2K1)
   05163 Human cytomegalovirus infection
    103017381 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103017381 (MAP2K1)
   05165 Human papillomavirus infection
    103017381 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103017381 (MAP2K1)
   01522 Endocrine resistance
    103017381 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103017381 (MAP2K1)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     103017381 (MAP2K1)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: STE group
  STE7 family
   103017381 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 NAD_binding_6
Other DBs
NCBI-GeneID: 103017381
NCBI-ProteinID: XP_007166128
UniProt: A0A383YTE9
LinkDB
Position
Un
AA seq 393 aa
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGI
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccggcccccgacggctccgcggtt
aatgggaccagctcggcggagaccaacctggaggccttgcaaaagaagctggaggagctg
gagctcgatgaacagcagcggaagcgccttgaggccttccttacgcagaagcagaaggtg
ggagaactgaaggatgacgactttgagaagatcagtgagctgggtgctggcaatggaggt
gtagtgttcaaggtctcccacaagccgtccggtctggttatggccagaaagctaattcac
ctggagatcaaacctgcaatccggaaccagatcatacgggagctgcaggttctacatgag
tgcaactccccttacattgtgggcttctacggtgcattctacagtgatggtgagatcagt
atctgcatggagcacatggatgggggttccttggatcaagtcctgaagaaagctggaaga
attcctgaacaaattttaggaaaagttagcattgctgtaataaaaggcctgacatacctg
agggagaagcacaagattatgcacagagatgtcaagccttccaacatcctagtgaactcc
cgtggggagatcaagctttgtgactttggggtcagcgggcagctcatcgactccatggcc
aactccttcgtgggcacaaggtcctacatgtcgccagaaagactccaggggactcattac
tcggtgcagtcggacatctggagcatggggctctctctggttgagatggcagtcgggagg
tatcccatccctcctccagatgccaaggagctggagctgatgtttgggtgccaggtggag
ggagatgcggctgagacaccgccccggccaaggactcccggaaggcccctcagctcttat
ggaatggacagccgacctcccatggcaatttttgagttgttggattacatagtcaatgag
cctcctccaaagttgcccagtggagtattcagtctggaatttcaagattttgtgaataaa
tgcttaataaaaaaccctgcagagagagcagatttgaagcaactcatggttcatgctttt
atcaagagatctgatgctgaggaagtggattttgcaggttggctctgctccaccatcggc
cttaaccagcccagcacacccacccacgcggctggcatctaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103018627
Entry
103018627         CDS       T03086                                 

Gene name
MAP2K2
Definition
(RefSeq) mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04071  Sphingolipid signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04140  Autophagy - animal
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04210  Apoptosis
bacu04218  Cellular senescence
bacu04270  Vascular smooth muscle contraction
bacu04370  VEGF signaling pathway
bacu04371  Apelin signaling pathway
bacu04540  Gap junction
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04613  Neutrophil extracellular trap formation
bacu04620  Toll-like receptor signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04720  Long-term potentiation
bacu04722  Neurotrophin signaling pathway
bacu04730  Long-term depression
bacu04810  Regulation of actin cytoskeleton
bacu04910  Insulin signaling pathway
bacu04912  GnRH signaling pathway
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04917  Prolactin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu04921  Oxytocin signaling pathway
bacu04926  Relaxin signaling pathway
bacu04929  GnRH secretion
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05132  Salmonella infection
bacu05135  Yersinia infection
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05216  Thyroid cancer
bacu05218  Melanoma
bacu05219  Bladder cancer
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05230  Central carbon metabolism in cancer
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103018627 (MAP2K2)
   04012 ErbB signaling pathway
    103018627 (MAP2K2)
   04014 Ras signaling pathway
    103018627 (MAP2K2)
   04015 Rap1 signaling pathway
    103018627 (MAP2K2)
   04370 VEGF signaling pathway
    103018627 (MAP2K2)
   04371 Apelin signaling pathway
    103018627 (MAP2K2)
   04066 HIF-1 signaling pathway
    103018627 (MAP2K2)
   04068 FoxO signaling pathway
    103018627 (MAP2K2)
   04072 Phospholipase D signaling pathway
    103018627 (MAP2K2)
   04071 Sphingolipid signaling pathway
    103018627 (MAP2K2)
   04024 cAMP signaling pathway
    103018627 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    103018627 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    103018627 (MAP2K2)
   04150 mTOR signaling pathway
    103018627 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103018627 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    103018627 (MAP2K2)
   04218 Cellular senescence
    103018627 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103018627 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    103018627 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103018627 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103018627 (MAP2K2)
   04620 Toll-like receptor signaling pathway
    103018627 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    103018627 (MAP2K2)
   04660 T cell receptor signaling pathway
    103018627 (MAP2K2)
   04662 B cell receptor signaling pathway
    103018627 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    103018627 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103018627 (MAP2K2)
   04929 GnRH secretion
    103018627 (MAP2K2)
   04912 GnRH signaling pathway
    103018627 (MAP2K2)
   04915 Estrogen signaling pathway
    103018627 (MAP2K2)
   04917 Prolactin signaling pathway
    103018627 (MAP2K2)
   04921 Oxytocin signaling pathway
    103018627 (MAP2K2)
   04926 Relaxin signaling pathway
    103018627 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    103018627 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    103018627 (MAP2K2)
   04916 Melanogenesis
    103018627 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103018627 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    103018627 (MAP2K2)
   04730 Long-term depression
    103018627 (MAP2K2)
   04722 Neurotrophin signaling pathway
    103018627 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103018627 (MAP2K2)
   05206 MicroRNAs in cancer
    103018627 (MAP2K2)
   05205 Proteoglycans in cancer
    103018627 (MAP2K2)
   05230 Central carbon metabolism in cancer
    103018627 (MAP2K2)
   05231 Choline metabolism in cancer
    103018627 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103018627 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103018627 (MAP2K2)
   05225 Hepatocellular carcinoma
    103018627 (MAP2K2)
   05226 Gastric cancer
    103018627 (MAP2K2)
   05214 Glioma
    103018627 (MAP2K2)
   05216 Thyroid cancer
    103018627 (MAP2K2)
   05221 Acute myeloid leukemia
    103018627 (MAP2K2)
   05220 Chronic myeloid leukemia
    103018627 (MAP2K2)
   05218 Melanoma
    103018627 (MAP2K2)
   05211 Renal cell carcinoma
    103018627 (MAP2K2)
   05219 Bladder cancer
    103018627 (MAP2K2)
   05215 Prostate cancer
    103018627 (MAP2K2)
   05213 Endometrial cancer
    103018627 (MAP2K2)
   05224 Breast cancer
    103018627 (MAP2K2)
   05223 Non-small cell lung cancer
    103018627 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103018627 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    103018627 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103018627 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103018627 (MAP2K2)
   05135 Yersinia infection
    103018627 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103018627 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    103018627 (MAP2K2)
   05161 Hepatitis B
    103018627 (MAP2K2)
   05160 Hepatitis C
    103018627 (MAP2K2)
   05164 Influenza A
    103018627 (MAP2K2)
   05163 Human cytomegalovirus infection
    103018627 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103018627 (MAP2K2)
   05165 Human papillomavirus infection
    103018627 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103018627 (MAP2K2)
   01522 Endocrine resistance
    103018627 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103018627 (MAP2K2)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     103018627 (MAP2K2)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: STE group
  STE7 family
   103018627 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 103018627
NCBI-ProteinID: XP_007169239
UniProt: A0A383Z2X0
LinkDB
Position
Un
AA seq 303 aa
MARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQ
VLKEAKRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSG
QLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEA
IFGRPMVDGAEGEPHSISPRPRPPGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPNGV
FTQDFQEFVNKCLIKNPAERADLKMLMNHAFIKRSEVEEVDFAGWLCKTLRLNQPSTPTR
TAV
NT seq 912 nt   +upstreamnt  +downstreamnt
atggcaagaaagctgatccacctggagatcaagccagccatccggaaccagatcatccgt
gagctgcaggtgctgcatgagtgtaactccccgtacatcgtgggcttctacggggccttc
tacagcgacggcgagatcagcatctgcatggagcacatggacggtggctccctggaccag
gtgttgaaagaagccaagagaatccccgaagagatcctggggaaggtcagcatcgcggtt
ctgcggggcctggcgtatctccgggagaagcaccagatcatgcaccgagatgtgaagcca
tccaacatcctcgtcaactcccgaggggagatcaagctgtgcgacttcggggtgagcggg
cagctcatcgactccatggccaactccttcgtggggacgcggtcctacatgtctccggag
cggctgcaaggcactcactactcggtgcagtcagacatctggagcatgggcctgtccctg
gtggagctgtctattggaaggtaccccatccccccgccggacgccaaggagctggaggcc
atatttggccggcccatggtcgacggcgcagaaggagagcctcacagcatctcgccgcgg
ccgagaccccccggacgccccatcagcggtcatgggatggacagccggccggccatggca
atctttgagctgctggactacatcgtgaacgagcctcctcccaagctgcccaacggcgtc
ttcacccaggacttccaggagtttgtaaataaatgcctaattaagaacccagcagagcga
gcagatctgaagatgctcatgaaccacgccttcatcaagcggtccgaggtggaagaagtg
gattttgccggctggttgtgtaaaacgctgcggctgaaccagcccagcacgcccacgcgc
accgccgtctga

DBGET integrated database retrieval system