KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017537
Entry
103017537         CDS       T03086                                 

Gene name
DDB2
Definition
(RefSeq) damage specific DNA binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu03420  Nucleotide excision repair
bacu04115  p53 signaling pathway
bacu04120  Ubiquitin mediated proteolysis
bacu05161  Hepatitis B
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05210  Colorectal cancer
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05216  Thyroid cancer
bacu05217  Basal cell carcinoma
bacu05218  Melanoma
bacu05220  Chronic myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103017537 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    103017537 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    103017537 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103017537 (DDB2)
   05202 Transcriptional misregulation in cancer
    103017537 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103017537 (DDB2)
   05212 Pancreatic cancer
    103017537 (DDB2)
   05225 Hepatocellular carcinoma
    103017537 (DDB2)
   05226 Gastric cancer
    103017537 (DDB2)
   05214 Glioma
    103017537 (DDB2)
   05216 Thyroid cancer
    103017537 (DDB2)
   05220 Chronic myeloid leukemia
    103017537 (DDB2)
   05217 Basal cell carcinoma
    103017537 (DDB2)
   05218 Melanoma
    103017537 (DDB2)
   05213 Endometrial cancer
    103017537 (DDB2)
   05224 Breast cancer
    103017537 (DDB2)
   05222 Small cell lung cancer
    103017537 (DDB2)
   05223 Non-small cell lung cancer
    103017537 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103017537 (DDB2)
   05169 Epstein-Barr virus infection
    103017537 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bacu04121]
    103017537 (DDB2)
   03400 DNA repair and recombination proteins [BR:bacu03400]
    103017537 (DDB2)
Ubiquitin system [BR:bacu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     103017537 (DDB2)
DNA repair and recombination proteins [BR:bacu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      103017537 (DDB2)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 103017537
NCBI-ProteinID: XP_007181244
UniProt: A0A384A1J7
LinkDB
Position
Un
AA seq 457 aa
MAPRKRPETQKTPEVVVRPKSKRNRSPRELEPEAKKLCLKGPGPSRRFDSGCLWAGLASL
RVPPPCSIVRALHQHKLGTAAWPSLQQGLQQSFLNSLASYRIFQKAAPFDRRATSLAWHP
THPSTLAVGSKGGDILLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFFTSSMEGTT
RLQDFKGNTLRVFTSSGTCNFWFCSLDVSVKSRVVVTGDKVGNVILLNMDGRELWNLRMH
KKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKSSFLYSLLHRHPVNAAHFSPDGA
QLLTTDQKSEIRVYSASQWDCPPSLIPHPHRHFQHLTPIKATWHPRYNLIVVGRYPDPNF
KSCTSHELRTIDVFDGSSGKMMYQLYDPESSGIMSVRLGPSNNNGRKQGFTLPYWIKNDQ
KLILMCPSPSTFIPSSCLSPCLCSSMSSIPWGTHWPL
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggctcccaggaaacgcccagaaacccagaagacccccgaagtggttgtgcgccccaag
agcaagaggaacagaagcccccgggagctggagcccgaggccaagaagctctgtttgaag
ggccccggtcctagcagaagatttgactcaggctgcctttgggcggggttggctagcctg
cgggtcccgccaccatgcagcatcgtcagggccctccaccagcataagctgggcacagct
gcctggccatcactacagcagggtctccagcagtcctttttgaactctctggcttcttac
cggatattccaaaaggctgccccttttgacaggagggccacatccctggcgtggcaccca
actcaccccagcaccctggctgtgggttccaaagggggagatatcttgctctggaacttt
ggcataaaggacaaacccaccttcattaaagggattggagctggagggagcatcactggg
ctgaagtttaaccctctcaataccaaccagtttttcacctcctcaatggagggaacaact
aggctgcaagactttaaaggcaacactctccgagtttttaccagctcaggcacctgcaac
ttctggttttgcagcctggatgtgtctgtcaaaagccgagtggtggtcacaggagataaa
gtgggtaacgtgatcctgctgaacatggacggcagggagctttggaatctgagaatgcac
aaaaagaaagtgacccacgtggccctgaacccgtgctgtgattggttcctggccacagcc
tccgtagatcaaacagtgaaaatctgggacctgcgccaggttagagggaaatccagcttc
ctctactcgctgctgcacaggcatcccgtcaatgcagctcatttcagtcccgacggtgct
cagctcctgaccactgaccagaagagtgagatccgggtttactctgcctcccagtgggac
tgccccccaagcctgatcccacaccctcatcgccacttccagcacctgacacccatcaag
gcaacctggcatcctcggtacaacctcattgtcgtgggccgatacccagatcctaatttc
aaaagttgtacctcccatgaattaaggacgatcgatgtgtttgatggaagctcaggaaag
atgatgtatcagctgtatgacccagaatcttctggtatcatgtcggtgaggcttgggccc
tcaaataataatgggaggaagcagggattcaccctaccttattggatcaaaaacgaccag
aaattaatcctcatgtgcccttctcccagtaccttcattccctcctcatgcttatcccct
tgtctctgcagctcaatgagttcaatcccatgggggacacactggcctctgtga

DBGET integrated database retrieval system