KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017733
Entry
103017733         CDS       T03086                                 

Gene name
FGFR1
Definition
(RefSeq) fibroblast growth factor receptor 1
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04520  Adherens junction
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04714  Thermogenesis
bacu04810  Regulation of actin cytoskeleton
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05215  Prostate cancer
bacu05218  Melanoma
bacu05224  Breast cancer
bacu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103017733 (FGFR1)
   04014 Ras signaling pathway
    103017733 (FGFR1)
   04015 Rap1 signaling pathway
    103017733 (FGFR1)
   04020 Calcium signaling pathway
    103017733 (FGFR1)
   04151 PI3K-Akt signaling pathway
    103017733 (FGFR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103017733 (FGFR1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103017733 (FGFR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103017733 (FGFR1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    103017733 (FGFR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    103017733 (FGFR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103017733 (FGFR1)
   05205 Proteoglycans in cancer
    103017733 (FGFR1)
   05230 Central carbon metabolism in cancer
    103017733 (FGFR1)
  09162 Cancer: specific types
   05218 Melanoma
    103017733 (FGFR1)
   05215 Prostate cancer
    103017733 (FGFR1)
   05224 Breast cancer
    103017733 (FGFR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103017733 (FGFR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:bacu04090]
    103017733 (FGFR1)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103017733 (FGFR1)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103017733 (FGFR1)
Protein kinases [BR:bacu01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   103017733 (FGFR1)
CD molecules [BR:bacu04090]
 Proteins
  103017733 (FGFR1)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103017733 (FGFR1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set FGFR3_TM C2-set_2 Ig_6 Pkinase_fungal DUF1615 DUF4611
Other DBs
NCBI-GeneID: 103017733
NCBI-ProteinID: XP_007178462
LinkDB
Position
Un
AA seq 861 aa
MAYFSFLITVSLHGRVKPTAESPWRCGSLSPTSNCGTGMWSWKCLLFWAVLVTAALCTAR
PAPTLPEQAAQPWGAPVEVESLLVHPGDLLQLRCRLRDDVQSINWLRDGVQLVESNRTRI
TGEEVEVRGSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKET
DNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDH
RIGGYKVRYATWSIIMDSVVPSDKGNYTCVVENEYGSINHTYQLDVVERSPHRPILQAGL
PANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDK
EMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYC
TGAFLISCMVGSVIIYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQVTVSADSSASMNSGV
LLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLD
KDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIV
EYASKGNLREYLQARRPPGLEYCYNPSRHPEEQLSSKDLVSCAYQVARGMEYLASKKCIH
RDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQS
DVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVP
SQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSFPDTRSSTCSSGEDSVFSHEPL
PEEPCLPRHPAQLANGGLKRR
NT seq 2586 nt   +upstreamnt  +downstreamnt
atggcgtatttcagcttcctcatcacagtcagcttgcacgggagggtcaagcccacggca
gagtctccatggaggtgcggaagcttgtcaccaacttctaactgcggaactgggatgtgg
agctggaagtgtctcctgttctgggctgtgctggtcacagccgcgctctgcactgccagg
ccagcgccaaccttgccggaacaagcagcccagccctggggagcccccgtggaagtggag
tccctcctggtccaccccggtgacctgctgcagctccgctgtcggctgcgggacgatgta
cagagcatcaactggctgcgggacggggtgcagctggtggaaagcaaccgcacccgcatc
acaggggaggaggtggaggtgcggggttccgtgcccgccgactccggcctctacgcctgt
gtgaccagcagcccctcgggcagcgataccacctacttctccgtcaacgtctcagatgct
ctcccctcctcggaggacgatgatgatgatgatgactcctcttcagaggagaaagagaca
gataacaccaaaccaaaccgtatgcccgtggctccgtattggacgtcgccagaaaagatg
gaaaagaaactgcacgcggtgccagctgccaagacagtgaagttcaaatgcccttccagc
gggacccctaaccccacgctgcgctggctgaaaaatggcaaagaattcaagcctgaccac
aggatcggaggctacaaggtccgttacgccacctggagcatcataatggactccgtggtg
ccttctgataagggcaactacacctgcgtcgtggagaacgagtacggcagcatcaaccac
acctaccagctcgatgtcgtggagcggtcccctcaccggcccatcctgcaggcagggttg
ccagccaacaagacagtggccctgggcagcaatgtggagttcatgtgtaaggtgtacagc
gacccgcagccccatatccagtggctaaagcacatcgaggtgaatgggagtaagattggt
ccggacaacctgccttatgtccagatcttgaagacggccggagttaataccaccgacaaa
gagatggaggtgctgcacttaaggaatgtctcctttgaggacgcgggggagtatacatgc
ttggcgggtaactctatcggactctcccatcactctgcatggttgaccgttctggaagcc
ctggaagagagaccggcggtgatgacctcgcccctgtacctggagatcatcatctattgc
acgggggccttcctcatctcctgcatggtggggtctgtcatcatctataagatgaagagc
ggcaccaagaagagtgacttccacagccagatggccgtgcacaagctggccaagagcatc
cctctgcgcagacaggtaacagtgtcggccgactccagcgcatccatgaactctggggtc
ctgctggttcggccctcgcgtctctcctccagcgggacccccatgctggctggggtctct
gaatacgagcttcccgaagaccctcgctgggagctgcctcgggacagactggttttaggc
aaacccctgggagagggctgctttgggcaggtggtgttggcggaggccattgggctggac
aaggacaaacccaaccgggtgaccaaagtggctgtgaagatgctgaagtcggatgcaaca
gagaaagacctgtcggacctgatctccgaaatggagatgatgaagatgatcgggaaacac
aagaatatcatcaacctgctgggggcctgcacgcaggacggccccctgtatgtcatcgtg
gagtacgcctccaagggcaacctccgagagtacctgcaggcccggaggccgccggggctg
gagtactgctacaaccccagccgtcatcccgaggagcagctgtcctccaaggacctggta
tcctgcgcctatcaggtggcccgaggcatggagtatctcgcctccaagaagtgcatacac
cgagacctggccgccaggaacgtgctggtgacggaggacaacgtgatgaagatcgcggac
tttggcctcgctcgtgacatccaccacatcgactactataaaaagacgaccaacggccga
ctgcctgtcaagtggatggcacccgaggccttgtttgaccggatctacacccaccagagc
gacgtgtggtcttttggggtgcttctgtgggaaatcttcactctgggcggctccccgtac
cctggcgtccctgtggaggagcttttcaagctgctgaaggagggtcatcgtatggacaag
cccagtaactgcaccaatgagctgtacatgatgatgcgagactgctggcacgcggtaccc
tctcaaagacctaccttcaagcagctggtggaagacctggaccgcatcgtggccttgacc
tccaaccaggagtacctggacctatcaatgcccctggaccagtactcccccagcttcccc
gacacccgcagctctacctgctcctctggggaggattccgtcttctctcacgagcccttg
cctgaggagccctgtctgccccgacacccggcccagctggccaatggcggactcaaacgg
cgctga

DBGET integrated database retrieval system