KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017808
Entry
103017808         CDS       T03086                                 

Gene name
MDM2
Definition
(RefSeq) MDM2 proto-oncogene
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu01524  Platinum drug resistance
bacu04068  FoxO signaling pathway
bacu04110  Cell cycle
bacu04115  p53 signaling pathway
bacu04120  Ubiquitin mediated proteolysis
bacu04144  Endocytosis
bacu04151  PI3K-Akt signaling pathway
bacu04218  Cellular senescence
bacu04625  C-type lectin receptor signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05203  Viral carcinogenesis
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05218  Melanoma
bacu05219  Bladder cancer
bacu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103017808 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103017808 (MDM2)
   04151 PI3K-Akt signaling pathway
    103017808 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103017808 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    103017808 (MDM2)
   04115 p53 signaling pathway
    103017808 (MDM2)
   04218 Cellular senescence
    103017808 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103017808 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103017808 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103017808 (MDM2)
   05202 Transcriptional misregulation in cancer
    103017808 (MDM2)
   05206 MicroRNAs in cancer
    103017808 (MDM2)
   05205 Proteoglycans in cancer
    103017808 (MDM2)
   05203 Viral carcinogenesis
    103017808 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    103017808 (MDM2)
   05220 Chronic myeloid leukemia
    103017808 (MDM2)
   05218 Melanoma
    103017808 (MDM2)
   05219 Bladder cancer
    103017808 (MDM2)
   05215 Prostate cancer
    103017808 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103017808 (MDM2)
   05169 Epstein-Barr virus infection
    103017808 (MDM2)
   05165 Human papillomavirus infection
    103017808 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103017808 (MDM2)
   01522 Endocrine resistance
    103017808 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103017808 (MDM2)
   04121 Ubiquitin system [BR:bacu04121]
    103017808 (MDM2)
Enzymes [BR:bacu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     103017808 (MDM2)
Membrane trafficking [BR:bacu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    103017808 (MDM2)
Ubiquitin system [BR:bacu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    103017808 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 103017808
NCBI-ProteinID: XP_007195107
UniProt: A0A384B6E6
LinkDB
Position
Un
AA seq 491 aa
MCNTNMSVSTDGAVSTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVIFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQEPSDSGT
SVSENRCHLEGGSVQKDLVQELQEEKPSSSDLVSRPSTSSRRRAVSETEENSDELPGERQ
RKRHKSDNISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCSEMNPPLPPHCNRCWALRENWLPEDKGKDKGKMSEKAKLENSAQVEEGFDVP
DCKKSTVNDSKESCVEENDDKITQASLSQESEDYSQPSTSNSIIYSSQEDVKEFEREETQ
DKEESVESSFPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtgtctactgatggtgctgtaagcacctcacagattccc
gcttcggaacaagagaccctggttagaccaaagccattgcttttgaagttgttgaagtct
gttggtgcacagaaggacacctatactatgaaagaggttatattttatcttggccagtat
attatgactaaacgattatatgatgagaaacaacagcatattgtgtattgttcaaatgat
cttctaggggatttgtttggagtgccaagcttctctgtgaaagagcacaggaaaatatat
acaatgatttatagaaacttggtggtagtcaatcagcaggaaccatcagattcaggcaca
tctgtgagtgaaaacaggtgtcaccttgaaggtgggagtgttcaaaaggaccttgtgcaa
gagctacaggaagagaaaccttcatcttcagatttggtttctagaccatctacctcatct
agaaggagagcagttagtgagacagaagaaaattcagatgaattacctggtgaacgacaa
agaaagcgccacaaatctgataatatttccctttcctttgatgaaagccttgctctgtgt
gtaataagggagatatgttgtgaaagaagcagtagcagtgaatcgacagggactccgtca
aatccggatcttgatgctggtgtaagtgaacattcaggtgattggttggatcaggattca
gtttcagatcaattcagtgtagaatttgaagttgagtctcttgattcagaagattatagc
cttagtgaagaaggacaagaactctcagatgaagatgatgaggtatatcgagttactgtg
tatcaggcaggggagagtgatacagattcatttgaagaagatcctgaaatttccttagct
gactattggaagtgtacttcatgcagtgaaatgaatcctccccttccacctcattgcaac
agatgttgggcccttcgtgaaaattggcttcctgaagataaagggaaagataaagggaaa
atgtctgagaaagccaaactagaaaactcagcacaagtagaagagggctttgatgtccct
gactgtaagaaatctacagtgaatgattccaaagaatcatgtgttgaggaaaatgatgat
aagatcacacaagcctccctatcccaagaaagtgaggactattctcagccatcaacttct
aatagtatcatttatagtagccaagaagatgtcaaagagtttgagagggaagaaacacaa
gacaaagaagaaagtgtggaatctagttttcctcttaatgccattgaaccttgtgtgatt
tgccaaggtcgacctaaaaatggttgcatcgtccatggcaaaacaggacatcttatggca
tgctttacatgtgcaaagaagctaaaaaaaaggaataagccctgccccgtatgcagacaa
ccaattcaaatgattgtgctaacttatttcccctag

DBGET integrated database retrieval system