KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017855
Entry
103017855         CDS       T03086                                 

Definition
(RefSeq) NF-kappa-B essential modulator-like
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01523  Antifolate resistance
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04062  Chemokine signaling pathway
bacu04064  NF-kappa B signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04210  Apoptosis
bacu04380  Osteoclast differentiation
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04622  RIG-I-like receptor signaling pathway
bacu04623  Cytosolic DNA-sensing pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04657  IL-17 signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04668  TNF signaling pathway
bacu04920  Adipocytokine signaling pathway
bacu05132  Salmonella infection
bacu05135  Yersinia infection
bacu05142  Chagas disease
bacu05145  Toxoplasmosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05212  Pancreatic cancer
bacu05215  Prostate cancer
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05222  Small cell lung cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05340  Primary immunodeficiency
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103017855
   04014 Ras signaling pathway
    103017855
   04064 NF-kappa B signaling pathway
    103017855
   04668 TNF signaling pathway
    103017855
   04151 PI3K-Akt signaling pathway
    103017855
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103017855
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103017855
   04621 NOD-like receptor signaling pathway
    103017855
   04622 RIG-I-like receptor signaling pathway
    103017855
   04623 Cytosolic DNA-sensing pathway
    103017855
   04625 C-type lectin receptor signaling pathway
    103017855
   04660 T cell receptor signaling pathway
    103017855
   04658 Th1 and Th2 cell differentiation
    103017855
   04659 Th17 cell differentiation
    103017855
   04657 IL-17 signaling pathway
    103017855
   04662 B cell receptor signaling pathway
    103017855
   04062 Chemokine signaling pathway
    103017855
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103017855
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103017855
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103017855
   05203 Viral carcinogenesis
    103017855
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103017855
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103017855
   05221 Acute myeloid leukemia
    103017855
   05220 Chronic myeloid leukemia
    103017855
   05215 Prostate cancer
    103017855
   05222 Small cell lung cancer
    103017855
  09163 Immune disease
   05340 Primary immunodeficiency
    103017855
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103017855
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103017855
   05135 Yersinia infection
    103017855
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103017855
   05170 Human immunodeficiency virus 1 infection
    103017855
   05162 Measles
    103017855
   05164 Influenza A
    103017855
   05161 Hepatitis B
    103017855
   05160 Hepatitis C
    103017855
   05168 Herpes simplex virus 1 infection
    103017855
   05163 Human cytomegalovirus infection
    103017855
   05167 Kaposi sarcoma-associated herpesvirus infection
    103017855
   05169 Epstein-Barr virus infection
    103017855
   05165 Human papillomavirus infection
    103017855
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103017855
   05142 Chagas disease
    103017855
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    103017855
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103017855
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   103017855
SSDB
Motif
Pfam: CC2-LZ zf_C2H2_10 NEMO zf_C2H2_ZHX
Other DBs
NCBI-GeneID: 103017855
NCBI-ProteinID: XP_007184663
LinkDB
Position
Un
AA seq 348 aa
MLRERCEELQRFQGSQREEKAFLMQKFQEARDLVERLSLEKWELHQQREQALQEVERLKT
YQQMAEDKASVKAQVTSLLGELQESQTRLEAATKERQALEGRVRAASEQARQLENEREAL
QQQHSVQVDQLRLQNQSVDAALRMERQAASEEKRKLAQLQVAYHQLFQEYDSHIKSSMVS
SERSRGLQLEELKQQLKQAEEALVAKQELIDKLKEEAEQHKIVMETVPVLKAQADIYKAD
FQAERQAREKLAEKKELVQEQLEQLQREYSRLKSSCQESARIEDMRKRHVEVSQPPLAPA
PAHHSFHLALPSQRRSPPEEPPNFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgctgcgggaacgctgcgaggagctgcagcgtttccagggcagccagagggaggagaag
gccttcctcatgcagaagttccaggaggcccgggacctggtggagaggctgagcctggag
aagtgggagctgcaccagcagagggagcaggccctgcaggaggtggagcgcctcaagaca
taccagcagatggccgaggacaaggcctcagtgaaagcccaggtgacatccttgctgggg
gagctgcaggagagccagactcgcttggaggccgccaccaaggagcggcaggctttggag
ggcagggtccgggccgccagcgagcaggcccggcagctggagaatgagcgcgaagcgctg
cagcagcagcacagcgtgcaggtggaccagctgcgcctgcagaaccagagcgtggacgcc
gccctgcgcatggagcgccaggctgcctcggaggagaagaggaagctggcccagctgcag
gtggcctatcaccagctcttccaggagtacgacagccacatcaagagcagcatggtgagc
agcgagcggagccgaggattgcagctggaagagctcaagcagcagctcaagcaggccgag
gaggccctggtggccaaacaggaactgatcgacaaactgaaggaagaggctgagcagcac
aagattgtgatggagacggttccggtgctgaaagcccaggcggacatctacaaggcggat
ttccaggccgagaggcaggcccgggagaagctggctgagaagaaggagctcgtgcaggag
cagctagagcagctgcagcgggagtacagcaggctgaagagcagctgtcaggagtcggcc
aggatcgaagacatgaggaagcggcatgtagaggtctcccagccccccttagcccctgcc
ccagctcatcactcctttcacctggccctgcccagccagaggagaagcccccccgaggag
ccgcccaacttctgctgccccaagtgccagtatcaggctcctgacatggacaccctgcag
atacacgtcatggagtgcatcgagtag

DBGET integrated database retrieval system