KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017861
Entry
103017861         CDS       T03086                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase 3
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00220  Arginine biosynthesis
bacu00330  Arginine and proline metabolism
bacu01100  Metabolic pathways
bacu04020  Calcium signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04071  Sphingolipid signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04370  VEGF signaling pathway
bacu04371  Apelin signaling pathway
bacu04611  Platelet activation
bacu04915  Estrogen signaling pathway
bacu04921  Oxytocin signaling pathway
bacu04926  Relaxin signaling pathway
bacu04931  Insulin resistance
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    103017861 (NOS3)
   00330 Arginine and proline metabolism
    103017861 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    103017861 (NOS3)
   04371 Apelin signaling pathway
    103017861 (NOS3)
   04066 HIF-1 signaling pathway
    103017861 (NOS3)
   04020 Calcium signaling pathway
    103017861 (NOS3)
   04071 Sphingolipid signaling pathway
    103017861 (NOS3)
   04022 cGMP-PKG signaling pathway
    103017861 (NOS3)
   04151 PI3K-Akt signaling pathway
    103017861 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103017861 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103017861 (NOS3)
   04921 Oxytocin signaling pathway
    103017861 (NOS3)
   04926 Relaxin signaling pathway
    103017861 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103017861 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103017861 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103017861 (NOS3)
Enzymes [BR:bacu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     103017861 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 DEC-1_N HTH_15
Other DBs
NCBI-GeneID: 103017861
NCBI-ProteinID: XP_007165449
UniProt: A0A383YRM3
LinkDB
Position
Un
AA seq 1205 aa
MGNLKSVGQEPGPPCGLGLGLGLGLCSKQGPASPAPEPSRAPPPAPPPAPDHSPAPHSPQ
LTRPPEGPKFPRVKNWEVGSITYDTLCAQSQQDGPCTPRRCLGSLVFPRKLQSRPSQGPP
PPEQLLSQARDFINQYYSSIKRSGSQAHKERLQEVEAEVGATGTYQLRESELVFGAKQAW
RNAPRCVGRIQWGKLQVFDARDCSSAQEMFTCICNHIKYATNRGNLRSAITVFPQRTPGR
GDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDE
APELFVLPPELVLEVPLEHPTLEWFSALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYM
STEIGTRDLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSYQLAKVTIV
DHHAATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYVLSPAFRYQPD
PWKGSTAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYASETGRAQSYAQQL
GRLFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYN
SSPRPEQHKSYKIRFNSISCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYP
HFCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRAWAQAAFQASCETFCVGEDAKA
AAQDIFSPKQSWEGQRYRLSAQAEGLQLLPGLIHVHRRKMFQATVLLVENLQSSKSTRAT
ILVRLDTGGQEGLQYQPGDHIGICPPNRPGLVEALMSRVEDPPPPTESVAVEQLEKGSPG
GPPPGRGRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPSEQQQLETLSQDPR
RYEEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSAHPGEIHLTVA
VLAYRTQDGLGPLHYGVCSTWLSQLKTGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGI
APFRGFWQERLHDIESKGLQPAPMTLVFGCRCSQLDHLYREEVQDAQQRGVFGRVLTAFS
REPDSPKTYVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATSVLQTVQRILATEGDME
LDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERHMRGAVPWAFDPPSP
DTPGP
NT seq 3618 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagcgtgggccaggagcccgggccaccctgcggcctggggctaggg
ctgggcctcgggctgtgcagcaagcagggcccggcctccccagcacccgagcccagccgg
gcaccgccacccgcacccccgcccgcgccagaccacagcccggctccccacagcccccag
ctaacccggcctccagaggggcccaagttcccccgtgtgaagaactgggaggtggggagc
atcacgtatgacactctgtgtgcgcagtcacagcaggacgggccctgcacccccagacgc
tgcctgggctccctggtgtttccacggaaactgcagagccgaccctcccagggccctcca
ccccctgagcagctgctgagccaggccagggacttcatcaaccaatactacagctccatc
aagaggagcggctcccaggctcacaaggagcggcttcaggaagtggaagccgaggtgggg
gccacgggcacctaccagcttcgtgagagcgagctggtgttcggggccaagcaggcctgg
cgcaacgccccccgctgcgtgggccggatccagtgggggaagctgcaggtgttcgacgcg
cgggattgcagctctgcacaggagatgttcacctgcatctgcaaccatatcaagtacgcc
accaaccggggcaacctccgttcggccatcacagtgttcccccagcgcactccgggccgc
ggagacttccgaatctggaacagccaactggtgcgctacgcgggctacaggcagcaggac
ggctctgtgaggggggacccagccaacgtggagatcaccgagctctgcatccagcacggc
tggaccccaggaaacggccgctttgatgtgctgccgctgctgctgcaggccccagatgag
gctccagaactctttgttctgccccccgaactggtcctcgaggtgcccctggagcacccc
acgctggagtggttctcggccctgggcctgcgctggtacgccctgccagcagtgtccaat
atgctgctggaaattgggggcctggagttccctgcagcccccttcagcggctggtacatg
agcacggagattggcacgcgggacctgtgtgatcctcaccgctacaacatcctggaggat
gtggccgtctgcatggacctggatacccggaccacctcatccctgtggaaagacaaggca
gccgtggaaatcaacttggctgtgctgcacagttaccagctcgccaaagtgaccatcgtg
gaccaccacgctgccacagcctccttcatgaagcacctggagaacgagcaaaaggccagg
gggggctgccctgccgactgggcctggatcgtgccccccatctcgggcagcctcacccca
gtcttccatcaggagatggtcaactatgtcctgtcccctgctttccgctaccagccagac
ccctggaaggggagcacagccaagggcaccggcatcaccaggaagaagacctttaaggaa
gtggccaatgcggtgaagatctctgcctcactcatgggcaccgtgatggcgaagcgagtg
aaggcgaccattctgtacgcctccgagaccggccgggcccagagctatgcacagcagctg
gggaggctcttccggaaggccttcgaccctcgggtcctgtgcatggatgagtatgatgtg
gtgtccctggagcacgagacgctggtgttggtggtgaccagcacctttgggaatggcgat
cccccagagaacggagagagttttgcagcggccctgatggagatgtcgggcccctacaac
agctcccctcggccagaacaacacaagagctacaaaatccgcttcaacagcatctcctgc
tcagacccgctggtgtcctcctggcggcggaagaggaaggagtccagtaataccgacagc
gcaggggcgctggggaccctcaggttctgtgtgtttgggctgggctcccgggcgtacccc
catttctgcgcctttgctcgtgcggtggacacgcggctggaagagctgggaggggagcgg
ctgcttcagctgggccagggcgatgagctatgcggccaggaggaggccttccgtgcctgg
gcccaggctgccttccaggcctcctgtgagacattctgcgtgggggaggatgccaaggcc
gcggcccaggacatcttcagccccaaacagagctgggaaggccagaggtaccggctgagc
gcccaggccgagggcctccagctgctgccaggcctgatccacgtgcacaggcggaagatg
ttccaggccacagtcctcttggtggaaaacctgcaaagcagcaagtccacccgggccacg
atcctggtgcgcctggacactggaggccaggaggggctccagtaccagccgggggaccac
ataggcatctgcccgcccaaccggccggggctcgtggaggcgctgatgagccgcgtggag
gacccgccgccgcccaccgagtctgtggcagtggagcagctggagaagggcagcccaggt
ggccctcctccaggcagggggcgggacccccggctgcccccgtgtacactgcgccaggct
ctcaccttcttcctggacatcacctccccgcccagccctcaacttcttcggctgctcagc
accctggcggaagagcccagcgagcagcagcaactcgagaccctcagccaggacccccgg
cgctacgaggagtggaagtggttccgctgccccacgctgctggaggtgctcgagcagttc
ccatccgtggcactgcctgccccgctactcctcacccagctgcccctgctccagccccgg
tactactcggtcagctcagcacccagcgcccatccaggagagatccacctcacggtagct
gtactggcatacaggacccaagatgggctgggccccctgcactatggagtctgctccacg
tggctgagccaactcaagactggagaccccgtaccctgcttcatcaggggggctccctcc
ttccggctgccgcctgatcccagcttgccctgcatcctcgtgggcccgggcactggcatc
gcccccttccggggattttggcaggagcggctacacgacatcgagagcaaagggctgcag
cctgcccccatgaccttggtgttcggctgccggtgctcccagctcgaccatctctaccgc
gaggaggtgcaggatgcccagcagcggggggtgtttggccgcgtcctcaccgccttctcc
cgggaacccgacagccctaagacctacgtgcaggacatcctgcggacggagctggctgct
gaggtgcaccgcgtgctgtgcctcgagcggggccacatgtttgtctgcggcgatgtcacc
atggcaaccagcgtcctgcagacggtgcagcgcatcttggcgacagagggcgacatggag
ctggatgaggccggcgacgtcatcggcgtgctgcgggatcagcaacgctatcacgaggac
attttcgggctcacgctgcgcacccaggaggtgacaagccgcatacgcacccagagcttt
tccttgcaggagcggcatatgcggggcgcagtgccctgggcgttcgacccgcccagccca
gacacccctggcccctga

DBGET integrated database retrieval system