KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017896
Entry
103017896         CDS       T03086                                 

Gene name
IL2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04060  Cytokine-cytokine receptor interaction
bacu04061  Viral protein interaction with cytokine and cytokine receptor
bacu04151  PI3K-Akt signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04630  Jak-STAT signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04672  Intestinal immune network for IgA production
bacu04940  Type I diabetes mellitus
bacu05135  Yersinia infection
bacu05142  Chagas disease (American trypanosomiasis)
bacu05162  Measles
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05320  Autoimmune thyroid disease
bacu05321  Inflammatory bowel disease (IBD)
bacu05330  Allograft rejection
bacu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    103017896 (IL2)
   04151 PI3K-Akt signaling pathway
    103017896 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103017896 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103017896 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103017896 (IL2)
   04660 T cell receptor signaling pathway
    103017896 (IL2)
   04658 Th1 and Th2 cell differentiation
    103017896 (IL2)
   04659 Th17 cell differentiation
    103017896 (IL2)
   04672 Intestinal immune network for IgA production
    103017896 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103017896 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103017896 (IL2)
   05321 Inflammatory bowel disease (IBD)
    103017896 (IL2)
   05330 Allograft rejection
    103017896 (IL2)
   05332 Graft-versus-host disease
    103017896 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103017896 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103017896 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103017896 (IL2)
   05162 Measles
    103017896 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    103017896 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103017896 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103017896 (IL2)
Cytokines and growth factors [BR:bacu04052]
 Cytokines
  Interleukins
   103017896 (IL2)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Haparin
  Cytokines
   103017896 (IL2)
SSDB
Motif
Pfam: IL2 TcdB_N
Other DBs
NCBI-GeneID: 103017896
NCBI-ProteinID: XP_007172457
UniProt: A0A383ZBN1
LinkDB
Position
Un
AA seq 154 aa
MYKMQLLSCIALTLALVANGAPTSSSTENTKEQVKSLLLDLQLLLKEINNYENLKLFRMP
TFKFYMPKKATELKHLQCLAEELKPLEDVLNAAQSKIQNSIDIKDLMDNINRIVLTLKGS
ETRFTCEYDDETVTAVEFLKKWITFCQSIYSTMT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaagatgcaactcttgtcttgcattgcactaactcttgcacttgtggcaaacggt
gcacctacttcaagctctacggagaacacaaaggaacaagtgaagtcactgctgctggat
ttacagttgcttttgaaggaaattaataattacgagaacctcaagctcttcaggatgccc
acatttaaattttacatgcccaagaaggctacagaattgaaacatcttcagtgtctagca
gaagaactcaagcctctggaggatgtgctaaatgctgctcaaagcaaaatccagaactcg
atagatatcaaggatttaatggacaatatcaatagaatagttttgacactaaagggttct
gaaacaagattcacatgtgaatatgacgatgagacagtaaccgctgtagaatttctgaaa
aaatggattaccttttgtcaaagcatctactcaacaatgacttga

DBGET integrated database retrieval system