KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017903
Entry
103017903         CDS       T03086                                 

Gene name
BCL2L1
Definition
(RefSeq) BCL2 like 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01524  Platinum drug resistance
bacu04014  Ras signaling pathway
bacu04064  NF-kappa B signaling pathway
bacu04115  p53 signaling pathway
bacu04137  Mitophagy - animal
bacu04140  Autophagy - animal
bacu04151  PI3K-Akt signaling pathway
bacu04210  Apoptosis
bacu04215  Apoptosis - multiple species
bacu04621  NOD-like receptor signaling pathway
bacu04630  JAK-STAT signaling pathway
bacu05012  Parkinson disease
bacu05014  Amyotrophic lateral sclerosis
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05145  Toxoplasmosis
bacu05162  Measles
bacu05166  Human T-cell leukemia virus 1 infection
bacu05168  Herpes simplex virus 1 infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05212  Pancreatic cancer
bacu05220  Chronic myeloid leukemia
bacu05222  Small cell lung cancer
bacu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103017903 (BCL2L1)
   04630 JAK-STAT signaling pathway
    103017903 (BCL2L1)
   04064 NF-kappa B signaling pathway
    103017903 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    103017903 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103017903 (BCL2L1)
   04137 Mitophagy - animal
    103017903 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    103017903 (BCL2L1)
   04215 Apoptosis - multiple species
    103017903 (BCL2L1)
   04115 p53 signaling pathway
    103017903 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103017903 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103017903 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    103017903 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103017903 (BCL2L1)
   05225 Hepatocellular carcinoma
    103017903 (BCL2L1)
   05220 Chronic myeloid leukemia
    103017903 (BCL2L1)
   05222 Small cell lung cancer
    103017903 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103017903 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    103017903 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    103017903 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103017903 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    103017903 (BCL2L1)
   05162 Measles
    103017903 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    103017903 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103017903 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103017903 (BCL2L1)
   01524 Platinum drug resistance
    103017903 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bacu01009]
    103017903 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bacu03036]
    103017903 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bacu02000]
    103017903 (BCL2L1)
Protein phosphatases and associated proteins [BR:bacu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103017903 (BCL2L1)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103017903 (BCL2L1)
Transporters [BR:bacu02000]
 Other transporters
  Pores ion channels [TC:1]
   103017903 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 103017903
NCBI-ProteinID: XP_007193372
UniProt: A0A384B138
LinkDB
Position
Un
AA seq 250 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVDENRTEAPEGTESDMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWTPSSLPGRMDSVDISKHDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGV
VLLGSLFSRK
NT seq 753 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggacgagaacagaactgaggccccagaaggg
actgaatcagacatggaaacccccagtgccatcaatggcaacccgtcctggcacctggca
gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg
atccccatggcagcggtgaagcaagcgctgagggaggcaggcgatgagtttgaactgagg
taccggcgggcattcagcgacctgacatcccagctccacatcaccccagggacggcatat
cagagctttgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcactgtgtgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctggacacccagttcccttcctgggagaatggactctgta
gacataagcaaacacgacactttcgtggaactctacgggaacaatgcagcagccgagagc
cggaagggccaggagcgcttcaaccgctggttcttgacgggcatgactgtggctggcgtg
gttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system