KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103018044
Entry
103018044         CDS       T03086                                 

Gene name
EML4
Definition
(RefSeq) echinoderm microtubule associated protein like 4
  KO
K15420  echinoderm microtubule-associated protein-like 4
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu05200  Pathways in cancer
bacu05223  Non-small cell lung cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103018044 (EML4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103018044 (EML4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    103018044 (EML4)
Cytoskeleton proteins [BR:bacu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EMAP
     103018044 (EML4)
SSDB
Motif
Pfam: HELP WD40 ANAPC4_WD40 Ribosomal_S7 SlyX
Other DBs
NCBI-GeneID: 103018044
NCBI-ProteinID: XP_007167169
UniProt: A0A383YWV8
LinkDB
Position
Un
AA seq 1000 aa
MDGFAGSLDDSISAASTSDVQDRLSALELRVQQQEDEITVLKAALADVLRRLTISEDHVA
SVKKSVPSKGQPGIREAISMSCITNGSGASRKPSHTSSVSIARKETLSSAAKSGTEKKKE
KPQGQREKKEDSHSNDQSPQIRASPSPQPSSQPLQIHRQTQESKNSTPTKSIKRPPTAEK
SHNSWENSDDTRNKLLRAVSTSKLISKVIKNADKHKDVIINQDMSFLSQPAKMSTREKNS
QEGEYVKMFMRGRPITMFIPSDVDNYDDIRTELPPEKLKLEWVYGYRGKDCRANVYLLPT
GEIVYFIASVVVLFNYEERTQRHYLGHTDCVKCLAIHPDKIRIATGQIAGVDKDGRPLQP
HVRVWDSVSLSTLQIIGLGTFERGVGCLDFSKADSGVHLCVIDDSNEHMLTVWDWQKKSK
GAEIKTTNEVVLAVEFHPTDANTIITCGKSHIFFWTWSGNSLTRKQGVFGKYEKPKFVQC
LTFLGNGDVLTGDSGGVILIWSKTTVEPTPGKGPKGVYQISKQIKAHDGSVFTLCQMRNG
MLLTGGGKDRKIILWDHDLNPEREIEVPDQYGTIRAVAEGKADQFLVGTSRNFILRGTFN
DGFQIEVQGHTDELWGLATHPFKDLLLTCAQDRQVCMWNSVEHRLEWTRLVDEPGHCADF
HPSGTVVAIGTHSGRWFVLDAETRDLVSIHTDGNEQLSVMRYSLDGTFLAVGSHDNFIYL
YVVSENGRKYSRHGKCTGHSSYITHLDWSPDNKYIMSNSGDYEILYWDIPNGCKLIRNRS
DCKDIDWTTYTCVLGFQVFGVWPEGSDGTDINALVRSHNRKVIAVADDFCKVHLFQYPCS
KAKAPSHKYSAHSSHVTNVSFTHNDSHLISTGGKDMSIIQWKLVEKLSLPQNEIVADTAL
TKAPISSTESVMQSDAPTPPPSQPVNETAEEESRISSSPTLLENSLEQTAGPSEDHSEEQ
SEGGSEDLGEPACEEPAPEMSEGQSAGALPGDQRDPSPLP
NT seq 3003 nt   +upstreamnt  +downstreamnt
atggacggtttcgccggcagcctcgatgatagtatttctgctgcaagtacttctgatgtg
caagatcgcctctcagcccttgagttacgagttcagcaacaagaagatgaaatcactgtg
ctaaaggcagctttggctgatgttttgaggcgtcttacaatctctgaagatcatgtagcc
tcagtgaaaaaatcagtcccaagtaaaggccagccaggcattcgagaagctatttccatg
tcctgtataaccaatgggagtggtgcaagtagaaaaccaagtcacaccagctctgtttca
atcgcaagaaaagaaactctttcatctgctgctaaaagtggtacagaaaaaaagaaagaa
aaaccacaaggacagagagaaaaaaaagaggactctcactctaatgatcaaagtccacaa
attcgagcatcaccttctccccagccctcttcacagcctctccaaatacacagacaaact
caagaaagcaagaattctactcccaccaaaagcataaaacgaccaccaacagctgaaaag
tcacataattcatgggaaaattcagacgatacccgtaataaattactgagggcagtttca
acatcaaaattaatatcaaaagttataaaaaatgcagacaagcataaagatgtcatcatc
aaccaagatatgtcatttttgtctcaaccagcaaaaatgtcaacccgtgaaaaaaacagc
caagaaggagaatatgttaaaatgtttatgcgaggtcgaccaattacaatgttcattcct
tctgatgttgacaactatgatgacatcagaacagagctgcctcctgagaagctcaaactg
gagtgggtatatggttatcgaggaaaggactgtcgagctaatgtttaccttcttcctacc
ggggaaatcgtttatttcatagcatcagtagtagtactatttaattatgaggagagaact
caacgacactacctgggtcatacagactgtgtgaaatgccttgctatacatcctgacaaa
attaggattgcaactggacagatagctggagtggataaggatggaaggcccctgcaaccc
catgtcagagtgtgggattcagttagtctatctacactgcagattattggacttggaact
tttgagcgtggagtaggatgcctggatttttcaaaagcagattcaggtgttcatttatgt
gttattgatgactccaatgaacatatgcttactgtatgggattggcagaagaaatcaaaa
ggagcagaaataaagacaacaaatgaagttgttttggctgtggaattccatccaacagat
gcaaataccataataacctgtggtaaatctcacatttttttctggacctggagtggcaat
tcactaacaagaaaacagggagtttttgggaaatatgaaaaaccaaaatttgtgcagtgt
ttgacattcttggggaatggagatgttcttactggagactcaggtggagtcatacttata
tggagcaaaactactgtagaacccacacctgggaaagggcctaaaggtgtttatcagatc
agcaaacaaatcaaagctcatgatggcagtgtgttcacactttgtcagatgagaaatggt
atgttattaactggaggcgggaaagacagaaaaataattctgtgggatcatgatctgaat
cctgaaagagaaatagaggtccctgatcagtatggaacaatcagagctgtagcagaaggg
aaggcagatcaatttttggtaggcacatcacgaaactttattttacggggaacgtttaac
gatggcttccaaatagaagtacagggtcatactgatgagctttggggtcttgccacgcac
cccttcaaagatttgctcttgacatgtgctcaggacagacaggtgtgcatgtggaactcg
gtggaacacaggctggaatggaccaggctcgtagatgaaccaggacactgtgcagatttt
catccaagtggcacagtggtggccataggaacgcactcaggcaggtggtttgttctggat
gcagaaaccagagatctagtttctatccacacagacgggaatgaacagctctctgtgatg
cgctactcattagatggcaccttcctggctgtgggatctcatgacaactttatttacctc
tatgtagtctcagaaaatggaagaaagtacagcagacatggaaagtgcactggacattcc
agctatatcacacaccttgactggtctccagacaacaagtacataatgtctaactcggga
gactatgagatcctgtactgggacattccaaatggctgcaaactaatcaggaatcgatca
gattgtaaggacatcgattggacgacatacacctgtgtgctaggctttcaagtctttggt
gtctggccagaaggatctgatgggacagatatcaatgcactggtgcgatcccacaataga
aaggtgatagctgttgctgatgacttttgcaaagtccatctgtttcagtatccctgctcc
aaagcaaaggctcccagtcacaagtacagtgcccacagcagccatgtcaccaatgtcagt
tttactcataatgacagtcacctgatttcaactggtggaaaagacatgagcatcattcag
tggaaacttgtggaaaagttatctttgcctcaaaatgagattgtagctgataccgcgctc
accaaagcccccatctcttccactgaaagtgtcatgcagtcagatgctcccacaccacct
ccttcccagcccgtaaacgagacagctgaagaagagagcaggataagcagttctcccacg
cttctggagaacagcctggagcagactgcggggcccagtgaagaccacagtgaggagcag
agtgaggggggcagcgaagacctcggtgagcctgcttgtgaagagccagcccccgagatg
agcgaggggcagagcgcaggcgctcttcccggggaccagcgagacccttcacccctgccc
taa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103020848
Entry
103020848         CDS       T03086                                 

Gene name
ALK
Definition
(RefSeq) anaplastic lymphoma receptor tyrosine kinase
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu05200  Pathways in cancer
bacu05223  Non-small cell lung cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103020848 (ALK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103020848 (ALK)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    103020848 (ALK)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103020848 (ALK)
Protein kinases [BR:bacu01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   103020848 (ALK)
CD molecules [BR:bacu04090]
 Proteins
  103020848 (ALK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase MAM Gly_rich Ldl_recept_a Nup96 FXa_inhibition
Other DBs
NCBI-GeneID: 103020848
NCBI-ProteinID: XP_007191493
UniProt: A0A384AW41
LinkDB
Position
Un
AA seq 1585 aa
MGAIGFLWLLLLLSPAASGSGTGTETGQRVGSPAMGPALQPREPLSYSRLQRKSLAVGSV
VPSLFRVYARDLLLPPPSPSEPRAGRLEARGSLALDCAPLLRLVGPPPGASSPAPARART
LSRVLKGGSVRKLRRAKQLVLELGEEAILEGCVGPPEEATAGLLQFNLTELFSWWIRHGE
GRLRIRLMPEKKASEVGREGRLSSAIRTSQPRLLFQIFATGTGHSSLESPTNVPSLPPDS
FAWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHNLGNQSWSWRRVPSEEASQ
MDLLDGPEEEHSKEMPRGAFLLLNTSMTSKHTILSPWMRSSSEHCRLAVSVHRHLQPSGR
YVAQLLPHNEAGREIPLVPTPGKHGWTVLQGRIGRPENPFRVALEYISSGNRSLSAVDFF
ALRNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHRDCAQGEDEGQLCSKLPAGFYC
NFEDGFCGWTQSSLSPHTPQWQVRTLKDARFQDHQGHALLLSTTDAPTSESATVTSATFP
APMKNSPCELRMSWLIRGVLQGNVSLVLVENKTGKEQSRMIWHVATMEGLSLWQWTVLPL
LDVADRFWLQIVAWWGPGSRATVAFSNISISLDCYLTIGGEDKMPQNTAPKSRNLFEGNP
NKEPKPWENTPKENPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYRNSNLSVVVGSEGPL
KGIQTWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFSLEKDDVLYILVGQQGE
DACPSTNQLIQKVCIGENNVIEEEIHVNKSVHEWAGGGGGGGGATYVFKMKDGVPVPLII
AAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWSGKSLLEGA
TGGHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAAANNDPEMDGEDGVSFIN
PLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKVICFCDHGTVLAEDGVS
CIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKL
SKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPN
DPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQALPRFILLELMA
GGDLKSFLRETRPRPNQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCP
GPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLW
EIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIIL
ERIEYCTQDPDVINTALPIEYGPLVEEEEKVPMRPKDPEGIPPLLVSAPQAKREEGHEPA
ARTALPSASSGKAGKKPVAAEASARGARAPAVKGGHVNMAFSQCNPPSELHQAQGSRNKP
TSLWNPTYGSWFTEKPTKKSNPPAKKEQRERGNAGGEGGRAILPPAATGRRASLRPEPEP
QTEGGARPLLPLDTCSSGCPTPFIC
NT seq 4758 nt   +upstreamnt  +downstreamnt
atgggagccatagggtttctgtggctgctgctgctgctttcaccggcagcctcaggctcc
gggaccgggaccgagaccggccagcgcgtgggctcaccagccatggggccggcgctgcag
ccccgggagccgctcagctactcgcgtctgcagaggaagagcctggcggtgggctctgtg
gtaccctctctctttcgcgtctatgctcgggaccttctgctgccgccgccgtccccttcg
gagccgagggctggccggctggaggcgcgcggctcgctggctcttgactgcgccccactg
cttaggctggtggggccaccacccggcgccagctctcccgccccggcccgggcacggacg
ctgtccagggtgctgaagggaggctcggttcgcaagctccggcgcgccaagcagctggtg
ctggagctgggagaggaggcgatccttgagggctgtgtagggcccccagaggaggcgact
gcggggctgctccagttcaacctcactgagctgttcagctggtggattcgccacggcgaa
ggacggctgaggatccgcctgatgcccgagaagaaggcgtcggaagtgggcagagaggga
aggctgtcctctgcgatccgcacctcccagccccgccttctcttccagatcttcgcgacc
gggactgggcatagctccttggagtcaccaacaaacgtgccttctcttcctcctgattct
tttgcctggaatctgacctggataatgaaagattccttccctttcctgtctcatcgtagc
cgatatggtctggagtgcagctttgacttcccctgtgagctggagtattcccctccactg
cacaaccttgggaaccagagctggtcctggcgccgtgtcccttccgaggaggcttcccag
atggacctgttggatgggcctgaagaggagcactccaaggagatgcccagaggtgccttc
ctcctcctcaacacgtcgatgacctccaagcacaccatcctgagtccgtggatgaggagc
agcagcgagcactgcaggctggccgtctcggtgcacaggcacctgcaaccctccgggagg
tacgtcgcccagctgctgccccacaatgaggctggaagagagatccccctggtacccact
ccaggaaagcatggttggactgtgctgcagggaagaattgggcgcccagagaacccattc
cgagtggccctggaatacatctcgagtggaaaccgaagcttatctgcagtggacttcttt
gccctgaggaactgcagcgaaggaacatccccgggctccaagatggccttgcagagttcc
ttcacttgctggaacgggacagtcctccagctcgggcaggcctgcgacttccaccgggac
tgtgcccagggagaagatgagggccagctgtgcagtaaactccctgctggtttttactgc
aacttcgaggatggattctgtggctggacccaaagctcactgtcaccccacacgccccag
tggcaagtcaggaccttaaaggatgcccggttccaggaccaccaaggccacgccctgttg
ctcagcaccactgatgcccccacctctgaaagtgctacggtgaccagcgctacgtttcct
gcaccgatgaagaactctccgtgcgagctccgaatgtcctggctcatccgtggagtcttg
cagggaaatgtctccttggtgctggtggagaacaaaaccgggaaggaacaaagcagaatg
atctggcatgttgccaccatggaaggcttgagcctgtggcagtggacggtgctgcctctc
cttgatgtggccgacaggttctggctgcagattgttgcgtggtggggaccaggatccaga
gccaccgtggctttcagcaatatctccatcagcctggactgctacctcaccattggtggg
gaggacaagatgccacagaatacagcacccaagtcaagaaatctgtttgagggaaaccca
aacaaggagccaaaaccctgggagaacacaccaaaagagaaccccatctttgaccctaca
gttcactggctgttcaccacatgcggggccagtgggccccacggcccgacgcaggcccag
tgcaacaatgcctaccggaactccaacctgagcgtggtggtggggagcgagggccccctg
aagggcatccagacctggaaggtgccagccaccgacacctacagcatatcaggctacgga
gccgctggcgggaaaggcgggaagaacaccatgatgcgatcccacggcgtgtctgtgctg
ggcatcttcagcctggagaaggacgacgtgctgtacatcctggtcgggcagcagggggaa
gatgcctgccccagtacaaaccagctaatccagaaagtctgcattggagagaacaacgtg
atagaagaagaaatccacgtgaacaaaagtgtgcacgagtgggcaggagggggcggagga
gggggcggagccacctacgtatttaagatgaaggatggagtgccagtgcccctgatcata
gcggccggcggtggcggcagggcctacggagccaagacagacacgttccacccagagaga
ctggagaataactcctcagttctagggctgaatggcaattccggagccgcaggtggtgga
ggtggctggaatgataacacttccttgctctggtctggaaagtctttgctggaaggtgcc
accggaggacattcctgcccccaggccatgaagaagtgggggtgggagaccagagggggt
ttcggagggggtggaggggggtgctcctcaggtggaggaggcggaggatacataggtggc
aatgcagccgcaaacaatgaccccgagatggacggggaggatggagtttccttcatcaat
ccactgggcatcctgtacaccccggctttaaaagtgatggagggccacggggaagtgaat
atcaagcattacctgaactgcagccactgtgaggtagatgagtgccacatggaccctgag
agccacaaggtcatctgcttctgcgaccacgggacagtgctggccgaggacggtgtctcc
tgcatagtgtcacccaccccggagccccacttgccactctcgctgatcctctccgtcgtg
acctctgccctcgtggccgccctcgtcctggctttctccggcatcatgatcgtgtaccgc
cggaagcaccaggagctgcaagccatgcagatggagctgcagagccccgagtacaagctg
agcaagctccgcacctccaccatcatgaccgactacaaccccaactactgttttgccggc
aagacctcctccatcagtgacctgaaggaggtgcccaggaaaaacatcaccctcatccgg
ggtctgggccacggcgcgtttggggaggtgtatgaaggtcaagtgtctggaatgcccaac
gacccgagccccctgcaagtggctgtaaagacgctgcctgaggtgtgttccgaacaggac
gaactggatttcctcatggaagccctgatcatcagcaagttcaaccaccagaacatcgtg
cgctgtatcggggtgagtctgcaagccctgccccgatttatcctgctggagctcatggcg
ggaggagacctcaagtccttcctccgagagacgcgccctcgtccgaatcagccctcctcc
ctggccatgctggacctcctgcatgtggctcgggacatcgcctgtggctgccagtatcta
gaggaaaatcacttcatccaccgggacattgctgccaggaactgtctcttgacctgtcca
ggccctggaagagtggccaagattggagacttcggaatggctcgagacatctaccgagcg
agctactaccgaaagggaggctgtgcgatgctgccggtcaaatggatgcccccggaggcc
ttcatggaaggaatatttacttctaaaacagacacgtggtccttcggagtgcttctgtgg
gaaatcttctctcttggatacatgccgtaccctagcaaaagcaaccaggaggttctggag
tttgtcaccagtggaggacggatggacccacctaagaactgccccgggcctgtataccgg
ataatgacccagtgctggcaacatcagcctgaagacaggcccaactttgccataattttg
gagaggattgaatactgcacccaggacccagatgtgatcaacactgctttgcccatagaa
tacgggcccctcgtggaagaggaagagaaggtgcccatgaggcccaaggaccctgaggga
atccctcctctgctggtctccgctccccaggccaagcgggaggagggccacgagccagcc
gcccgcacggctctgccttctgcctcctcgggcaaagccggcaagaagcccgtggccgca
gaggcctctgcccgaggcgccagggcgccggccgtgaaggggggacacgttaacatggca
ttctctcagtgtaacccgccctcggagctgcaccaagcccaggggtccagaaacaagccc
accagcctatggaacccaacttacggctcctggtttacagagaaacccaccaaaaagagc
aatcctccggcgaagaaggagcagcgcgagagggggaacgcgggcggcgagggcggccgt
gctatcctgccccccgcggccaccggccgccgagccagcctgcgccctgagcccgagccc
cagaccgagggcggcgcgcgcccgctccttccgcttgacacgtgctccagcggttgcccc
actccgttcatctgctaa

DBGET integrated database retrieval system