KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103018352
Entry
103018352         CDS       T03086                                 

Gene name
EIF4EBP1
Definition
(RefSeq) eukaryotic translation initiation factor 4E binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu03013  RNA transport
bacu04012  ErbB signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04211  Longevity regulating pathway
bacu04218  Cellular senescence
bacu04910  Insulin signaling pathway
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05221  Acute myeloid leukemia
bacu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    103018352 (EIF4EBP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103018352 (EIF4EBP1)
   04066 HIF-1 signaling pathway
    103018352 (EIF4EBP1)
   04151 PI3K-Akt signaling pathway
    103018352 (EIF4EBP1)
   04152 AMPK signaling pathway
    103018352 (EIF4EBP1)
   04150 mTOR signaling pathway
    103018352 (EIF4EBP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103018352 (EIF4EBP1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103018352 (EIF4EBP1)
  09149 Aging
   04211 Longevity regulating pathway
    103018352 (EIF4EBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    103018352 (EIF4EBP1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    103018352 (EIF4EBP1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103018352 (EIF4EBP1)
   05163 Human cytomegalovirus infection
    103018352 (EIF4EBP1)
   05165 Human papillomavirus infection
    103018352 (EIF4EBP1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103018352 (EIF4EBP1)
Messenger RNA biogenesis [BR:bacu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     103018352 (EIF4EBP1)
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 103018352
NCBI-ProteinID: XP_007170165
UniProt: A0A383Z4S0
LinkDB
Position
Un
AA seq 118 aa
MSSGSSCSQTPSRAIPATRRVVLGDGVHLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPRDLPTIPGVTSPVGGEPPPEAGQVHLSSSPEDKPAGGEESQFEMDI
NT seq 357 nt   +upstreamnt  +downstreamnt
atgtccagcggcagcagctgtagccagaccccaagccgggccatccccgccactcgccgg
gtggtcctcggcgacggcgtgcacctgcctcccggggactacagcaccacccccggcggc
acgctcttcagtaccaccccgggaggtaccaggatcatctacgaccggaagttcctaatg
gagtgtcggaactcacctgtgaccaaaacgcccccgcgggacctgcccaccattcccggg
gtcactagccctgtgggtggtgagccccctccagaagccggccaggtccacctgagcagc
agcccagaggacaagccggcgggcggtgaagagtcacaatttgagatggacatttaa

DBGET integrated database retrieval system