KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103018379Help
Entry
103018379         CDS       T03086                                 

Gene name
SMYD1
Definition
(RefSeq) SET and MYND domain containing 1
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00310  Lysine degradation
bacu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103018379 (SMYD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bacu03036]
    103018379 (SMYD1)
Enzymes [BR:bacu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     103018379 (SMYD1)
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     103018379 (SMYD1)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103018379 (SMYD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-MYND DUF3369 TPR_12
Motif
Other DBs
NCBI-GeneID: 103018379
NCBI-ProteinID: XP_007175368
UniProt: A0A383ZJN8
LinkDB All DBs
Position
Un
AA seq 490 aa AA seqDB search
MTIEGMENVEVFTSEGKGRGLKATKEFWAADVIFAERAYSAVVFDSLVNVVCHTCFKRQE
KLHRCGQCKFAHYCDRTCQKDAWLNHKNECSAIKRYGKVPNENIRLAARVMWRVEREGGG
LTEGCLVSVDDLQSHVEHFGEEEKKELRGDVDAFLQYWPPQSQQFSMQYISRIFGVINCN
GFTLSDQRGLQAVGVGIFPNLGLVNHDCWPNCTVIFNNGNHEAVKSMFHTQMRIELRALG
KISEGEELTVSYIDFLNVSEERKRQLKKQYYFDCTCEHCQKGLKDDLFLGVKDDPKPSQE
VVKEMIQFSKDTLEKIDKARSEGLYHKVVKLCRECLQKQEPVFADTNIYTLRMLSTVSEV
LSYLQAFEEASHYARRMVDGYMKLYHPNNAQLGMAIMRTGLTNWHAGNIEVGHSMICKAY
GILLVTHGPSHPITKDLEAMRMQTEMELRMFQQNEFMYHKMRKAALNNQPMQVMAEPSKE
PAPALFHKKQ
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgacaatagagggaatggagaacgtggaggtcttcacttctgagggcaaaggcaggggt
ctgaaggccactaaggagttctgggctgctgacgtcatctttgccgagcgggcttattcc
gcagtggtctttgacagccttgtgaatgttgtgtgccacacctgcttcaagaggcaggag
aagctccatcgctgcgggcagtgcaagtttgcccactactgtgaccgcacctgccagaag
gatgcttggctgaaccacaagaacgagtgttcggccatcaagagatacgggaaggtgccc
aatgagaacatcaggctggcggcgcgggtcatgtggcgggtggagagagagggcggcggg
ctcacggagggctgcctggtctccgtggacgacctgcagagccacgtggagcacttcggg
gaggaggagaagaaggagctgcggggggacgtggacgctttcctgcagtactggccgccc
cagagccagcagttcagcatgcagtacatctcgcggatcttcggcgtgattaactgcaat
ggtttcacgctcagtgaccagagaggcctgcaggcagtgggcgtgggcatcttccccaac
ctgggcctggtgaaccatgactgctggcccaactgcacggtcatatttaacaacggcaat
catgaggcagtgaaatccatgtttcacacccagatgagaattgaactccgggccctgggc
aagatctcagaaggagaggaattgaccgtgtcctatatcgacttccttaacgtcagcgaa
gaacgcaagaggcagctgaagaagcagtactactttgactgcacgtgtgagcactgccag
aaagggctgaaggacgacctcttcctgggtgtgaaagacgacccgaagccctctcaggag
gtggtgaaggagatgatacaattctccaaggatacgctggaaaaaattgacaaggctcgc
tctgagggtttgtaccacaaggttgtgaaattatgccgggagtgcctacagaagcaggag
ccagtgtttgctgacaccaacatctacacgctgcggatgctgagtaccgtttccgaggtc
ctctcctacctgcaggcctttgaggaggcctcacactacgccaggaggatggtggatggc
tatatgaagctgtatcaccccaacaatgcccagctgggcatggccatcatgcggacaggg
ctgaccaactggcatgctggcaacattgaggtggggcacagcatgatctgcaaagcctac
ggcattctcctggtgacacacggaccctcccaccccatcaccaaggacttagaggccatg
cggatgcagacggagatggagctgcgcatgttccaacagaacgagttcatgtaccacaag
atgcgcaaggccgccctgaacaaccagcccatgcaggtcatggccgaacccagcaaggaa
ccggcgccggctctgttccacaagaagcaatga

DBGET integrated database retrieval system