KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103018620
Entry
103018620         CDS       T03086                                 

Gene name
RBL2
Definition
(RefSeq) RB transcriptional corepressor like 2
  KO
K16332  retinoblastoma-like protein 2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04068  FoxO signaling pathway
bacu04110  Cell cycle
bacu04151  PI3K-Akt signaling pathway
bacu04218  Cellular senescence
bacu05165  Human papillomavirus infection
bacu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103018620 (RBL2)
   04151 PI3K-Akt signaling pathway
    103018620 (RBL2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103018620 (RBL2)
   04218 Cellular senescence
    103018620 (RBL2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103018620 (RBL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103018620 (RBL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103018620 (RBL2)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    103018620 (RBL2)
SSDB
Motif
Pfam: RB_A RB_B DUF3452 TFIIB
Other DBs
NCBI-GeneID: 103018620
NCBI-ProteinID: XP_007167662
UniProt: A0A383YXR0
LinkDB
Position
Un
AA seq 1160 aa
MAGGPGPRLPSGPAAQVCAMPSGGNQSPPPPPPPLPAAAASDEEEGDDAEAEDAAQPARS
PAPQTQQRFDELCSRLNMDEAARAEAWDSYRNMSESYTLEGNDLHWLACALYVACRKSVP
TVSKGTVEGNYVSLTRILRCSEQSLIEFFHKMKKWEDMANLPAQFRERTERLERNFTVSA
VIFKKYEPIFQDIFKYPQEEQPRQQRGRKQRRQPCTVSEVFHFCWVLFIYAKGNFPMISD
DLVNSYHLLLCALDLVYGNALQCSNRKELVNPNFKGLSEDFHAKDSKPSSDPPCVIEKLC
SLHDGLVLEAKGIKEHFWKPYIRKLFEKKLLKGKEENLTGFLEPGNFGESFKAINKAYEE
YVLSAGNLDERIFLGEDAGEEIGTLARCLNTGSGTETAERVQVKNILQQHFDKSKALRIS
TPLTGVRYIKGNSPCVTPVSTATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIA
NRLKEMYEIYSQHSQPDEDISNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLGDMDLS
GILEQDAFHRSLLACCLEVVTFSYKPPGNFPCITEIFDVPLYHFYKVIEVFIRAEDGLCR
EVVKHLNQIEEQILDHLAWKPESPLWDRIRDNENRVPTCEEVMPPQNLERADEICIAGSP
LTPRRVSEVRADAGGLGRSITSPTTLYDRYSSPTASSTRRRLFVENDSPTDGGTPGRIPP
QPLVNAVPVQNVSGEAVSVTPVPGQTLVTMATATVTANNGQTVTIPVQGIANENGGITFF
PVQVNVGGQAQAVTGSIQPLSAQALAGSLSSQQVTGTTLQVPGQVAIQQISPGGQQQKQG
LPLTSSNIRPRKTSSLSLFFRKVYHLAGVRLRDLCAKLDISDELRKKIWTCFEFSIIQCP
ELMMDRHLDQLLMCAIYVMAKVTKEDKSFQNIMRCYRTQPQARSQVYRSVLIKGKRKRRN
SGSSDSRSHQNSPTELNKDRTSRDSSPVMRSSSTLPVPQPSSAPPTPTRLTGANSDVEEE
ERGDLIQFYNNIYIKQIKTFAMKYSQANAMDAPPLSPYPFVRTGSPRRIQLSQNHPVYIS
PHKNEAMLSPREKIFYYFSNSPSKRLREINSMIRTGETPTKKRGILLEDGSESPAKRICP
ENHSALLRRLQDVANDRGSH
NT seq 3483 nt   +upstreamnt  +downstreamnt
atggctgggggcccaggccctcggctcccctcaggccccgccgcccaggtgtgcgctatg
ccgtcgggaggcaaccaatcgccgccgccgcccccccctccccttccggcggcggcggcc
tcggatgaggaggagggggacgatgccgaggcggaggacgcagcgcagccggcccggtcg
ccggcccctcagacccaacagcggttcgacgagctgtgcagccgcctgaacatggacgag
gcggcgcgggccgaggcctgggacagctaccggaacatgagcgagagctacacgctggag
ggaaatgatcttcattggttagcatgtgccttatatgtggcttgcagaaaatctgtgcca
actgtaagcaaagggacagttgaaggaaactatgtatctttaactagaatcctgagatgt
tcagagcagagcttaattgaattttttcacaagatgaagaaatgggaagacatggcaaac
ctacccgcacagttcagagaacggactgagagattagaaagaaacttcactgtttctgct
gtaatctttaagaaatatgaacccatttttcaggacatttttaaatatcctcaagaggag
caacctcgtcaacaaagaggaagaaaacagcggcgacagccctgtaccgtgtctgaagtt
ttccatttttgttgggtgctttttatttatgcaaaaggtaatttccccatgattagtgac
gatttggttaattcttatcatcttctactgtgtgctttggacttagtttatggaaatgcc
cttcaatgttccaatcgtaaagaacttgtgaaccctaattttaaaggcctatctgaagat
tttcacgctaaggattctaaaccttcctccgacccaccttgtgtcattgagaaactctgt
tccttacatgacggcctagttttggaagcaaagggaataaaggaacatttctggaaaccc
tatattaggaaactttttgaaaaaaagctccttaagggaaaagaagaaaatcttactggt
tttttagaacctgggaattttggagagagttttaaagccatcaataaggcctatgaggag
tatgttttatctgccgggaatttagacgagcggatttttcttggagaggatgctggagag
gaaattggcaccctcgcaaggtgtttgaatactggttcaggaacagagactgctgaaaga
gtgcaggtgaaaaacatcttgcagcagcactttgacaagtctaaagcacttaggatctct
accccacttactggtgtgaggtacattaagggtaacagcccttgtgtgactccagtttcc
acagctacacatagcttgagtcgtcttcacaccatgctcacaggcctcaggaatgcacca
agtgagaaactggaacagattctaaggacgtgttccagagatccaacccaggctatagcc
aacagattgaaagaaatgtatgaaatatattctcagcattcccagccagatgaggatatc
agtaattgtgctaaagaaattgccagcaaacattttcgttttgcagagatgctttactat
aaagtattagaatctgttattgagcaggaacaaaaaagactgggagacatggatttatct
ggcattctggaacaagatgcattccacagatcgctcttggcctgctgccttgaggtcgtc
actttttcttataagcctcctgggaattttccatgtattactgaaatatttgatgtacca
ctttatcatttttacaaggtgatagaagtattcattagagcagaagatggcctttgtaga
gaagtggtaaaacaccttaatcagattgaagaacagatcttggatcatttggcgtggaaa
ccagagtctccactatgggacagaattagagacaatgaaaacagagttcctacatgcgaa
gaggtcatgccacctcagaacctggaaagagcggatgaaatttgtattgctggctcccct
ttgactcccagaagggtgagtgaagttcgtgctgatgctggaggacttggaagaagcata
acgtctccaaccacattatacgataggtacagttctccaacagccagctctaccagaagg
cggctatttgttgagaatgatagccccactgatggagggacacctggccgcatcccccca
cagcctctagtcaatgctgtccctgtgcagaatgtgtctggggaggctgtttctgtcaca
ccagttcctggacagactttggtcaccatggcaacagccactgtcacagccaacaatgga
caaacagtgactattcctgtacaaggcattgccaatgaaaatggaggaataacattcttt
ccagtccaagtcaatgttggggggcaggcacaagctgtgactggttccatccagcccctc
agtgctcaggccctggctggaagcttaagctctcaacaggtgacaggaacgaccttgcaa
gtccctggtcaggtggccattcaacagatttccccaggtggacaacagcagaaacaaggc
ctgcctttaaccagcagcaacattagacccaggaagaccagctctttatcgcttttcttt
agaaaggtttatcacttagcaggtgtccgtcttcgggacctttgtgctaaattggatatt
tcagatgaactgaggaaaaaaatctggacctgctttgaattctccataattcagtgtcct
gaacttatgatggacagacatctggaccagttgttaatgtgtgccatttatgtgatggca
aaggtcacaaaagaagacaagtccttccagaatattatgcgttgctataggactcagcca
caggcccggagccaggtatatagaagtgttttgataaaagggaaaaggaaaagaagaaat
tctggcagcagtgatagcagaagccatcagaattctccaacagaactaaacaaagacaga
accagtagagactccagtcctgtcatgaggtcaagcagcaccttgccagttccacagcct
agcagtgcccctcctacacctactcgtctcacaggtgccaacagtgatgtggaagaggag
gagaggggagaccttattcagttctacaacaacatctacataaaacaaattaaaacattt
gccatgaagtactcacaggcaaatgcaatggatgctcctccactctctccctatccgttt
gtaagaacaggctctcctcgccgaatacagttgtctcaaaatcatcctgtgtacatatcc
ccgcataaaaatgaagcaatgctttctcctcgagaaaagattttctactacttcagcaac
agtccttcaaagagactgagagaaattaacagtatgatacggacaggagaaacgcccacc
aaaaagagagggattcttctggaagatggaagtgaatcacctgcaaaaagaatttgccca
gaaaatcattctgccttattacgccgtctccaagatgtagctaatgaccgaggttcccac
tga

DBGET integrated database retrieval system