KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103018658
Entry
103018658         CDS       T03086                                 

Gene name
HES1
Definition
(RefSeq) hes family bHLH transcription factor 1
  KO
K06054  hairy and enhancer of split 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu03460  Fanconi anemia pathway
bacu04330  Notch signaling pathway
bacu04950  Maturity onset diabetes of the young
bacu05165  Human papillomavirus infection
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    103018658 (HES1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103018658 (HES1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103018658 (HES1)
  09162 Cancer: specific types
   05224 Breast cancer
    103018658 (HES1)
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    103018658 (HES1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    103018658 (HES1)
   05165 Human papillomavirus infection
    103018658 (HES1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103018658 (HES1)
   03400 DNA repair and recombination proteins [BR:bacu03400]
    103018658 (HES1)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    103018658 (HES1)
DNA repair and recombination proteins [BR:bacu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex binding factors
     103018658 (HES1)
SSDB
Motif
Pfam: Hairy_orange HLH
Other DBs
NCBI-GeneID: 103018658
NCBI-ProteinID: XP_007195234
UniProt: A0A384B7I3
LinkDB
Position
Un
AA seq 280 aa
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKVRAPIMEKRRRARINESLSQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE
VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAP
FAPPPPLVPIPGGAAPPPGGAPCKLGSPAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAH
SGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
NT seq 843 nt   +upstreamnt  +downstreamnt
atgccagctgatataatggagaaaaattcctcgtccccggtggctgctaccccagccagt
gtcaacacgacaccggataaaccaaagacagcatctgagcacagaaaggtaagggcacct
atcatggagaaaagacgaagagcaagaataaatgaaagtctgagccagctgaaaacactg
attttggatgctcttaagaaagatagctcacggcattctaagctggagaaggcagacatt
ctggaaatgacagtgaagcacctccggaacctgcagcgggcgcagatgacggccgcgcta
agcacagacccgagcgtgctggggaagtaccgcgccggcttcagcgagtgcatgaacgag
gtgacccgcttcctgtccacgtgtgagggcgttaacaccgaggtgcgcacccggctcctc
ggccacctggccaactgcatgacccagatcaacgccatgacctaccctgggcagccgcac
cccgccttacaggcgccgccgccaccccctccgggacccggaggtccgcagcacgcgccg
ttcgcgccgcctccgccgctcgtgcccatccccgggggtgcggcgccccctcccggcggc
gcgccctgcaagctgggcagcccagctggagaggcggctaaggtgttcggtggcttccag
gtggtgccggctcccgacggccagtttgccttcctcatccccaacggggccttcgctcac
agcggcccagtcatcccagtctacaccagcaacagcgggacctccgtgggccccaacgcg
gtgtcgccttccagcggcccctcgctcacggcggactccatgtggaggccgtggcggaac
tga

DBGET integrated database retrieval system