KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103018997
Entry
103018997         CDS       T03086                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04390  Hippo signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu05200  Pathways in cancer
bacu05218  Melanoma
bacu05224  Breast cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103018997 (FGF1)
   04014 Ras signaling pathway
    103018997 (FGF1)
   04015 Rap1 signaling pathway
    103018997 (FGF1)
   04390 Hippo signaling pathway
    103018997 (FGF1)
   04151 PI3K-Akt signaling pathway
    103018997 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103018997 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103018997 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    103018997 (FGF1)
   05218 Melanoma
    103018997 (FGF1)
   05224 Breast cancer
    103018997 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103018997 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103018997 (FGF1)
Cytokines and growth factors [BR:bacu04052]
 Growth factors
  Growth factors (RTK binding)
   103018997 (FGF1)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   103018997 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 103018997
NCBI-ProteinID: XP_007194219
UniProt: A0A384B4I1
LinkDB
Position
Un
AA seq 189 aa
MSEVCCSTKDFKALWGKKPIASSLESAITRSCSAMAEGEITTFTALTEKFNLPPGNYKKP
KLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDG
LLYGSQTPNEECLFLERLEENHYNTYASKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAIL
FLPLPVSSD
NT seq 570 nt   +upstreamnt  +downstreamnt
atgagtgaagtttgctgctcaaccaaagacttcaaggctctgtggggaaaaaagcctatt
gccagcagccttgaaagcgccataaccaggagctgctcagccatggctgaaggggaaatc
acaaccttcacagccctgaccgagaagtttaatctgcctccagggaattacaagaagccc
aaactcctctactgtagcaacgggggccacttcctgaggatccttccagacggcacagtg
gatgggacacgggacaggagtgaccagcacattcagctgcagctcagtgcggaaagcgtg
ggggaggtgtatataaagagtacggagactggccagtacttggccatggacaccgacggg
cttttgtacggctcacagacacccaatgaggaatgtttgttcctggaaaggttggaggag
aaccattacaacacctacgcatccaagaagcatgcagaaaagaattggttcgttggtctc
aagaagaacggaagctgcaaacgcggtcctcggactcactacggccagaaagcaatcttg
tttctccccctgccagtctcctctgattaa

DBGET integrated database retrieval system