KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103019097
Entry
103019097         CDS       T03086                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta 1
  KO
K02105  catenin beta 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04015  Rap1 signaling pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04510  Focal adhesion
bacu04520  Adherens junction
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04670  Leukocyte transendothelial migration
bacu04916  Melanogenesis
bacu04919  Thyroid hormone signaling pathway
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05100  Bacterial invasion of epithelial cells
bacu05132  Salmonella infection
bacu05160  Hepatitis C
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05210  Colorectal cancer
bacu05213  Endometrial cancer
bacu05215  Prostate cancer
bacu05216  Thyroid cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05412  Arrhythmogenic right ventricular cardiomyopathy
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103019097 (CTNNB1)
   04310 Wnt signaling pathway
    103019097 (CTNNB1)
   04390 Hippo signaling pathway
    103019097 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103019097 (CTNNB1)
   04520 Adherens junction
    103019097 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103019097 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    103019097 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103019097 (CTNNB1)
   04916 Melanogenesis
    103019097 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103019097 (CTNNB1)
   05205 Proteoglycans in cancer
    103019097 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103019097 (CTNNB1)
   05225 Hepatocellular carcinoma
    103019097 (CTNNB1)
   05226 Gastric cancer
    103019097 (CTNNB1)
   05216 Thyroid cancer
    103019097 (CTNNB1)
   05217 Basal cell carcinoma
    103019097 (CTNNB1)
   05215 Prostate cancer
    103019097 (CTNNB1)
   05213 Endometrial cancer
    103019097 (CTNNB1)
   05224 Breast cancer
    103019097 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103019097 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    103019097 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103019097 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103019097 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103019097 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103019097 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    103019097 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    103019097 (CTNNB1)
   05163 Human cytomegalovirus infection
    103019097 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103019097 (CTNNB1)
   05165 Human papillomavirus infection
    103019097 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 HEAT_2 Adaptin_N HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 103019097
NCBI-ProteinID: XP_007193586
UniProt: A0A384B1J6
LinkDB
Position
Un
AA seq 767 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHHFFLLPSSPVDSVLFY
AITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLI
ILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPS
QRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKN
KMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVV
VKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMG
GTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVA
AGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRL
SVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPM
MEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL
NT seq 2304 nt   +upstreamnt  +downstreamnt
atggctacccaagctgacttgatggagctggacatggccatggagccagacagaaaagca
gctgttagtcactggcagcaacagtcttacctggactctggaatccattctggtgccact
accacagctccttctctaagtggtaaaggcaatcctgaggaagaggatgtggataccacc
caagtcctgtatgagtgggagcagggattttctcagtccttcactcaagaacaagtagct
gatatcgatggacagtatgcaatgactcgagctcagagggtacgagctgctatgttccct
gagacattagatgagggcatgcagatcccatctacacagtttgatgccgctcatcccact
aatgtccagcgtctggctgaaccatcacagatgctgaaacatgcagttgtaaatttgatt
aactatcaagatgatgcagaacttgccacacgtgcaatccctgaattgacaaaactgcta
aatgatgaagaccaggtggtggttaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacacgccatcatgcgttctcctcagatggtgtctgctattgtacgc
accatgcagaatacaaatgatgtggagacagctcgctgtactgctgggaccttgcacaat
ctttcccatcatcacttttttcttcttcccagttcaccagtggattctgtattgttttat
gccattacaactctccacaaccttttattgcatcaggaaggagctaaaatggcagtgcgt
ttagctggcgggctgcagaaaatggttgccttgctcaacaaaacaaatgttaaattcttg
gctattacaacagactgccttcagattttagcttatggcaatcaagaaagcaagctgatc
attttggctagtggtggacctcaagctttagtgaatataatgaggacctacacctatgag
aaactactgtggaccacaagcagagtcctgaaggtgctgtctgtctgctctagtaataag
ccggctattgtcgaagctggtggaatgcaagctttaggacttcacctgacagatccaagt
caacgtcttgttcagaattgtctttggactctgaggaatctttcagatgctgcaactaaa
caggaagggatggaaggtcttcttgggacccttgttcagcttctgggctcagatgatata
aatgtggtcacctgcgcagctggaattctttctaatctcacttgcaataattacaagaac
aagatgatggtgtgccaagtgggtggtatagaggctcttgtgcgtactgtccttcgtgct
ggtgacagggaggatatcactgagcctgccatctgtgctcttcgtcatctgaccagccga
caccaggaagctgagatggcccagaatgctgttcgccttcactatggactgccagttgtg
gttaaactcctacatccaccatcccattggcctctgatcaaggctaccgttggattgatc
cgaaatcttgccctttgtcccgcaaatcacgcacctttgcgtgagcagggtgccattcca
cgactagttcagttgctggttcgtgcacatcaggatacccagcgccgtacatctatgggt
gggacacagcagcagtttgtggagggggtccgcatggaagaaatagttgaaggttgtact
ggagcccttcacatcctagctcgggatgttcacaaccgaattgttatcagaggcctaaat
accattccattgtttgtgcagctgctttattctcccattgaaaatatccaaagagtagct
gcaggggtcctctgtgaactcgctcaggacaaggaggccgcagaagccattgaagctgag
ggggccacagcccctctgacagagctacttcactctaggaacgaaggtgtggcaacatac
gcagctgctgttttgttccgaatgtctgaggacaagccacaggattataagaagcggctt
tcggttgagctgaccagttctctcttcagaacggagccaatggcttggaatgagactgct
gatcttggacttgatatcggtgcccagggagaaccccttggatatcgccaggatgatccc
agctatcgttcttttcactctggtggatacggccaggatgccttgggtatggaccccatg
atggagcatgagatgggcggccaccaccctggtgctgactatccagttgatgggctgcca
gatctggggcatgcccaggacctcatggatgggctgcctccaggtgacagcaatcagctg
gcctggtttgatactgacctgtaa

DBGET integrated database retrieval system