KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103019307
Entry
103019307         CDS       T03086                                 

Gene name
THBS1
Definition
(RefSeq) thrombospondin 1
  KO
K16857  thrombospondin 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04015  Rap1 signaling pathway
bacu04115  p53 signaling pathway
bacu04145  Phagosome
bacu04151  PI3K-Akt signaling pathway
bacu04350  TGF-beta signaling pathway
bacu04510  Focal adhesion
bacu04512  ECM-receptor interaction
bacu05144  Malaria
bacu05165  Human papillomavirus infection
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103019307 (THBS1)
   04350 TGF-beta signaling pathway
    103019307 (THBS1)
   04151 PI3K-Akt signaling pathway
    103019307 (THBS1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    103019307 (THBS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    103019307 (THBS1)
  09143 Cell growth and death
   04115 p53 signaling pathway
    103019307 (THBS1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103019307 (THBS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    103019307 (THBS1)
   05205 Proteoglycans in cancer
    103019307 (THBS1)
  09162 Cancer: specific types
   05219 Bladder cancer
    103019307 (THBS1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103019307 (THBS1)
  09174 Infectious disease: parasitic
   05144 Malaria
    103019307 (THBS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103019307 (THBS1)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103019307 (THBS1)
   04990 Domain-containing proteins not elsewhere classified [BR:bacu04990]
    103019307 (THBS1)
Membrane trafficking [BR:bacu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    103019307 (THBS1)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   103019307 (THBS1)
Domain-containing proteins not elsewhere classified [BR:bacu04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   103019307 (THBS1)
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC EGF_3 cEGF TSP1_ADAMTS EGF_CA Laminin_G_3 Laminin_G_2 TSP1_CCN EGF Laminin_G_1
Other DBs
NCBI-GeneID: 103019307
NCBI-ProteinID: XP_007180483
UniProt: A0A383ZZD6
LinkDB
Position
Un
AA seq 1170 aa
MGLAWALSVLFLWHVCGSNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFR
IEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLAVERKDHSGQVFSVV
SNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQSIFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELVNELRRPPLCYHNGVQYRNNEEWTVDSCTECRCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACQKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPAPQFGGKDCVGDVTENQI
CNKQDCPIDGCLSNPCFADVKCTSYPDGSWKCGACPPGYSGNGIQCKDVDECKEVPDACF
NHNGEHRCENTDPGYNCLPCPPRFTGSQPFGRGVEHATTNKQVCKPRNPCTDGTHDCNKN
AKCNYLSHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNEDLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDQDNVPDIDDICPENVDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDLKYECRDS
NT seq 3513 nt   +upstreamnt  +downstreamnt
atggggctggcctgggcactcagtgtcctgttcctgtggcatgtgtgcggctccaaccgc
attccagagtctgggggagacaacagcgtgttcgacatctttgaactcacgggggctgcc
cgcaagggttctgggcgccgactggtgaagggtcccgacccttccagcccagctttccgc
atcgaggatgccaacctgatcccccctgtgcctgacgacaagttccaagacctagtggat
gctgtgcgggccgagaaaggtttcctcctcctggcctccctgaggcaaatgaagaagacc
cggggcacgctgctggccgtggagcggaaagaccactccggccaggtcttcagcgtggtc
tccaatggcaaggcgggcaccctggacctgagcctgaccgtgcaggggaagcagcatgtg
gtgtcggtggaagaagcactcctggcaaccggccagtggaagagcatcaccctgtttgtg
caggaggacagggcccagctgtacatcgactgtgagaagatggagaatgctgagctggac
gttcccatccaaagcatcttcaccagggacctggccagcattgccagactccgcatcgcc
aaaggaggtgtcaatgacaatttccagggcgtgctgcagaatgtgagatttgtctttgga
accacaccagaagacatcctcaggaacaaaggctgctccagctctaccagtgtccttctc
acccttgacaacaatgtggtgaacggttccagccctgccatccgcaccaactacattggc
cacaagacaaaggatctgcaagccatctgcggcatctcctgtgacgagctgtccagcatg
gtcctggagctcaggggcctgcgcaccatcgtgaccacgctgcaggacagcatccgcaaa
gtgactgaagagaacaaagagctggtcaatgagctgaggaggcccccgctctgctaccac
aatggagtccagtacaggaataacgaggagtggacggtggacagctgcactgagtgtcgc
tgccagaactcggttaccatctgcaaaaaagtgtcctgcccgatcatgccctgctccaat
gccacagttcctgatggagaatgctgcccgcggtgttggcccagcgactctgcggacgat
ggctggtccccatggtctgagtggacctcttgctctgtgacgtgtggcaacggaatccag
cagcgcggccgctcctgcgacagcctcaacaacagatgcgagggctcctccgtgcagaca
cggacctgccacattcaggagtgtgacaagagatttaaacaggatggcggctggagccac
tggtccccgtggtcgtcttgttctgtaacatgtggagacggtgtgatcacaaggatccgg
ctctgcaactctcccagcccccagatgaatgggaagccatgtgagggcgaagctcgggag
accaaagcctgccagaaagacgcctgccccatcaatggaggctggggaccctggtcaccg
tgggacatctgttccgtcacctgtggaggaggggtgcagaaacgtagccggctctgcaac
aaccccgcaccccagtttggaggcaaggactgcgttggtgatgtgacagaaaaccagatc
tgcaacaagcaggactgtcccattgatgggtgcctgtccaatccctgctttgctgacgtc
aagtgtaccagctaccctgatggcagctggaagtgtggtgcttgtcccccgggctacagc
ggaaatggcatccagtgcaaagatgttgatgagtgcaaagaagtccctgatgcctgcttc
aaccacaatggagagcacaggtgtgagaacacagatcccggctacaactgcctgccctgc
ccgccacgcttcactggctcgcagccctttggccggggcgtggaacatgccaccaccaac
aaacaggtgtgcaagccccgcaacccctgcacggatggcacacacgactgcaacaagaat
gccaagtgcaactacctgagccactacagtgaccccatgtaccgctgcgagtgcaagccc
ggctacgccggcaacggcatcatctgtggggaagacacagacctggacggctggcccaac
gaagacctggtgtgcgtggccaatgcaacttaccactgcaaaaaggataactgccccaac
cttcccaactcagggcaggaagactatgacaaggacgggatcggagatgcctgtgacgat
gatgatgacaatgataaaattccagatgacagggacaactgtccgttccattacaaccca
gcccagtacgactatgacagagacgacgtgggagaccgctgtgacaactgcccctacaac
cacaacccagaccaggctgacacggacaacaacggggaaggagacgcctgcgcggcagac
attgatggggacggtatcctcaatgaacgggacaactgccagtatgtctacaatgtggac
cagagagacactgacatggatggggttggagatcagtgtgacaactgccccctggaacac
aatccagatcagctcgactctgactcggaccgcattggagatacctgtgacaacaatcag
gacatcgatgaagacggccaccagaacaacctggacaactgtccctatgtgcccaacgcc
aaccaggccgaccatgacaaggacggcaagggcgatgcctgtgaccatgacgatgacaat
gacggcattcctgatgacagggacaactgcaggctcgtgcccaatcctgaccagaaggat
tctgatggtgatggtcgaggtgatgcttgcaaagatgattttgaccaggacaacgtgcca
gacatcgatgacatctgtcccgaaaacgttgacatcagtgagaccgatttccgccgattc
cagatgattcccctagatcccaaagggacatcccaaaatgaccctaactgggttgtacgc
catcagggtaaagaactcgtccagactgtcaactgtgatcctggacttgctgtaggttat
gatgagtttaatgctgtggacttcagtggcaccttcttcatcaacaccgagagggatgat
gattatgccggatttgtctttggctatcagtccagcagccgcttctacgttgtgatgtgg
aagcaagtcactcagtcctactgggacaccaaccccacaagggctcagggatactccggc
ctttctgtgaaggtcgtgaactccaccacggggcctggcgagcacctgcggaatgccctg
tggcacacaggaaacacccccggccaggtacgcacgctgtggcatgaccctcgtcacata
ggctggaaagatttcaccgcctacagatggcgtctgagccacaggccaaagacgggtttc
attagagtggtgatgtatgaagggaagaaaatcatggccgactcaggacccatctatgac
aaaacctatgctggcggtaggctagggttgttcgtcttctctcaagaaatggtgttcttc
tctgacctgaaatatgaatgcagagattcctaa

DBGET integrated database retrieval system