KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103019317
Entry
103019317         CDS       T03086                                 

Gene name
CDKN2C
Definition
(RefSeq) cyclin dependent kinase inhibitor 2C
  KO
K06622  cyclin-dependent kinase inhibitor 2C
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04110  Cell cycle
bacu04934  Cushing syndrome
bacu05166  Human T-cell leukemia virus 1 infection
bacu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103019317 (CDKN2C)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    103019317 (CDKN2C)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103019317 (CDKN2C)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103019317 (CDKN2C)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103019317 (CDKN2C)
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank Ank_3 DUF1843
Other DBs
NCBI-GeneID: 103019317
NCBI-ProteinID: XP_007164544
UniProt: A0A383YP29
LinkDB
Position
Un
AA seq 168 aa
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRG
ANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLPVVE
FLVKHTACKVGHRNHQGDTACDLARLYRRNEVVSLMEGNRAEGAANLQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atggccgagccttgggggaacgagttggcgtccgcagctgccaggggggacctagagcaa
cttactagtttgttgcaaaataatgtaaacgtcaatgcacaaaatggatttggaaggact
gcgctgcaggttatgaaacttggaaatcccgagattgccaggagactactacttagaggt
gctaatcccgatttgaaagaccgaactggtttcgctgtcattcacgatgcagccagagca
ggtttcctggacactttacagactttgctggagtttcaagctgatgttaacatcgaggat
aatgaagggaacctgcccttgcacttggctgccaaagaaggccacctccccgtggtggag
ttccttgtgaagcacacggcctgcaaagtggggcatcggaaccatcagggggacaccgcc
tgcgacttggccaggctctaccggagaaacgaggtcgttagcctgatggagggaaaccgg
gcggagggagctgcgaatctgcaatga

DBGET integrated database retrieval system