KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103019344Help
Entry
103019344         CDS       T03086                                 

Gene name
PARK7
Definition
(RefSeq) Parkinsonism associated deglycase
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05012 Parkinson disease
    103019344 (PARK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bacu01002]
    103019344 (PARK7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacu04147]
    103019344 (PARK7)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     103019344 (PARK7)
Peptidases [BR:bacu01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   103019344 (PARK7)
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103019344 (PARK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Motif
Other DBs
NCBI-GeneID: 103019344
NCBI-ProteinID: XP_007170102
LinkDB All DBs
Position
Un
AA seq 189 aa AA seqDB search
MAAKRALVILATGAEEMETVIPVDVMRRAGIKVTIAGLAGKDPVQCSRDVVICPDASLED
AKKEGPYDVVVMPGGGLGAQNLSQSSAVKEILKEQEKRKGLIAAICAGPTALLAHEIGFG
SKVTTHPLAKDKMMDGSHYSYSENRVERDGLILTSRGPGTSFEFALAIVEALAGKEVADQ
VKAPLVLKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaagagagctctggtcatcctggctacaggagcagaggagatggagacggtc
atccctgtcgatgtcatgaggcgagctggaattaaggtcaccattgcaggtctggctgga
aaagacccggtacagtgtagccgagatgttgtcatttgtcctgatgccagtctagaagat
gcaaaaaaagagggaccttacgacgtggtggttatgccaggaggcggtctgggcgcacag
aatttatcccagtcctctgctgtgaaggagatactgaaggaacaagaaaagaggaagggc
ctcatcgccgcaatctgtgcgggacctacggctctgttggctcatgaaataggttttgga
agcaaagttacaacacacccacttgctaaagacaaaatgatggacggaagtcattacagc
tactcagagaaccgtgtggaaagggacggcctgatcctcaccagccgggggccgggaacc
agcttcgagtttgctctggcaattgtcgaggcgctggccggcaaggaggtggccgaccaa
gtgaaggccccgctggttcttaaagattag

DBGET integrated database retrieval system