KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103019389
Entry
103019389         CDS       T03086                                 

Gene name
CACNA1C
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04020  Calcium signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04260  Cardiac muscle contraction
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04270  Vascular smooth muscle contraction
bacu04713  Circadian entrainment
bacu04720  Long-term potentiation
bacu04723  Retrograde endocannabinoid signaling
bacu04724  Glutamatergic synapse
bacu04725  Cholinergic synapse
bacu04726  Serotonergic synapse
bacu04727  GABAergic synapse
bacu04728  Dopaminergic synapse
bacu04742  Taste transduction
bacu04911  Insulin secretion
bacu04912  GnRH signaling pathway
bacu04921  Oxytocin signaling pathway
bacu04924  Renin secretion
bacu04925  Aldosterone synthesis and secretion
bacu04927  Cortisol synthesis and secretion
bacu04929  GnRH secretion
bacu04930  Type II diabetes mellitus
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu05010  Alzheimer disease
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05031  Amphetamine addiction
bacu05410  Hypertrophic cardiomyopathy
bacu05412  Arrhythmogenic right ventricular cardiomyopathy
bacu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103019389 (CACNA1C)
   04020 Calcium signaling pathway
    103019389 (CACNA1C)
   04024 cAMP signaling pathway
    103019389 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    103019389 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103019389 (CACNA1C)
   04929 GnRH secretion
    103019389 (CACNA1C)
   04912 GnRH signaling pathway
    103019389 (CACNA1C)
   04921 Oxytocin signaling pathway
    103019389 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    103019389 (CACNA1C)
   04924 Renin secretion
    103019389 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    103019389 (CACNA1C)
   04927 Cortisol synthesis and secretion
    103019389 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103019389 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    103019389 (CACNA1C)
   04270 Vascular smooth muscle contraction
    103019389 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    103019389 (CACNA1C)
   04727 GABAergic synapse
    103019389 (CACNA1C)
   04725 Cholinergic synapse
    103019389 (CACNA1C)
   04728 Dopaminergic synapse
    103019389 (CACNA1C)
   04726 Serotonergic synapse
    103019389 (CACNA1C)
   04720 Long-term potentiation
    103019389 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    103019389 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    103019389 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103019389 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103019389 (CACNA1C)
   05020 Prion disease
    103019389 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    103019389 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    103019389 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103019389 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103019389 (CACNA1C)
   05414 Dilated cardiomyopathy
    103019389 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103019389 (CACNA1C)
   04934 Cushing syndrome
    103019389 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bacu04040]
    103019389 (CACNA1C)
Ion channels [BR:bacu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103019389 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 103019389
NCBI-ProteinID: XP_007178712
LinkDB
Position
Un
AA seq 2273 aa
MLRAFLPPTTPGYRPLPSRPAEIQVGFKGTVVREAQLSCSYITLGGPSYGSPRPAHANMN
ANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPKK
QGSTMATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDD
SNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAI
LEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHI
ALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGVADVPAEDDPSPCALETGHGRQCQNGTV
CKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIF
GSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPEN
EDEGLDEEKPRNMSMPTSETESVNTENVAGGDIEGESCGARLAHRISKSKFSRYWRRWNR
FCRRKCRAAVKSSIFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAEM
LLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKIT
REDKAFGFVAQVGFGSGVTDINCASGPGVEGGVGTAGAQPAGVASSQTLTAGVWSSVRIL
PAEQMPVQPLASVQALFTTRQPSWGERDPGTRGHSGHRHQDQTDIEKDRGAGSAGPSHRP
ARRLHLAATVLFGCVIQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYIL
LNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEVVEKPAVEETKEEKI
ELKSITADGESPPATKINMDDLQPNENEDKSSYPNPETTGEEDEEEPEMPVGPRPRPLSE
LHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVNDSIFTNLILFFILLSSISLAAEDPVQ
HTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF
GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFA
CIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAA
MMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISVFFIIYIIIIAFFMMNIFVGF
VIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYL
MFVLILLNTICLAMQHYGQSCLFKIAMNVLNMLFTGLFTVEMILKLIAFKPKGYFSDPWN
VFDCLIVIGSVIDVILSETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPFMN
AEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQVPPGPPPGKISKTLNAIW
MMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMP
GKKCAPESEPGSSAEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWS
ILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMN
MPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPP
AGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDLGPEIRR
AISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVGYYPSDSRSAFPQTLTTQRP
LHISKAGTSQSDAESPSHEKLVDSTFTPSSYSSMGSNANINNANNTALGRCPRPAGQPGA
VSVSTVEGRGPPLSPAVQVQGASWRLSSKRCPSRDSLIAMVCQEEAPRDETCDLRTDEDA
EYGSEPSLISTEMLSYQDDENRQLAPPEEGRRDVRLSPKRGFLRSASLGRRASFHLECLK
RQKNPGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHPPGALPPPHATPPATPGPAWPP
RPVPTLRLEGAESSDKLTSSFPSVHCGPWAGEPTPCGAGGSIRRARPVSLTVPSPAGPRG
RPFHGSASSLVEAVLISEGLGRFAQDPKFLEATTQELADACDMTIEEMESAADNILSGGA
RQSPNGTLLPCANCRDPGPDREGGAEDAAWAPSPEPRQGGEEPWDSRAFASSL
NT seq 6822 nt   +upstreamnt  +downstreamnt
atgctgcgagccttcctcccacccaccacgcctgggtaccggccgctgcccagccgcccc
gccgagatccaggtgggctttaagggcactgtggtgcgtgaggctcagctcagctgttcc
tacatcactcttggaggtcccagctatggcagcccgcgcccggctcacgccaacatgaac
gccaacgcggccgcggggctggcacctgagcacatccccacaccgggggccgccctgtcc
tggcaggcggccattgacgcggcccggcaggccaagctgatgggcagcgctggcaacgcc
accatctccacggtcagctccacgcagcggaagcggcagcagtacgggaagcccaagaaa
cagggcagcacgatggccacccgcccgccccgtgccctgctctgcctgaccctcaagaac
cccatccggagggcgtgcatcagcatcgtcgagtggaagccatttgaaatcattatttta
ctgaccatttttgccaactgtgtggccttagcgatctatattccctttccagaggacgac
tccaacgccaccaactccaacctggaacgggtggagtatctctttctcatcatttttact
gtggaagcatttttaaaagtcatagcctatgggctcctctttcaccccaatgcttacctc
cgcaacggctggaacttgctggattttatcattgtggttgtcgggcttttcagtgccatc
ttagagcaagcgaccaaagccgacggggccaacgccctgggagggaagggggctggattc
gacgtgaaggcgctcagggcgttccgcgtgctgcggcccctgcggctggtgtccggggtc
ccgagtctccaggtggtcctgaactccatcatcaaggccatggtgcccctcctgcacatc
gccctgctcgtgctctttgttataatcatctacgccatcatcgggctggagctcttcatg
gggaagatgcacaagacctgctacaaccaggaaggtgtcgcagatgtcccagcagaagac
gacccctccccctgtgccctggagacgggccacgggcggcagtgccagaacggcacggtg
tgcaagccgggctgggatgggcccaagcacggcatcaccaacttcgacaacttcgccttc
gccatgctgaccgtgttccagtgcatcaccatggagggctggaccgacgtcctctactgg
atgcaggacgctatgggctacgagttaccctgggtgtattttgtcagtctggtcatcttt
ggatcctttttcgttctaaatctggttcttggtgtgttgagcggagagttttccaaagag
agggagaaggccaaggcccggggcgacttccagaagctgcgggagaagcagcagctggag
gaggacctgaagggctacctggactggatcacgcaggcggaggacatcgaccctgagaac
gaggacgagggcttggacgaggagaaaccccgcaacatgagcatgcccaccagtgagacc
gagtctgtcaacactgaaaacgtggctggaggtgacatcgagggagagagctgcggggcc
aggctggcccacaggatctccaagtcgaagttcagccgctactggcgccggtggaatcgg
ttctgcaggcggaagtgccgcgcggccgtgaagtcgagcatcttctactggcttgtcatc
ttcctggttttcctcaacacgctcaccatcgcctctgagcactacaaccaaccccactgg
ctcacggaagtccaagacacggccaacaaggccctgctggccctgttcacggcggagatg
ctgctcaagatgtacagcctggggctgcaggcctacttcgtgtccctcttcaaccgcttc
gactgcttcatcgtgtgcggtggcatcctggagaccatcctggtggagaccaagatcatg
tcgcccctgggcatctccgtgctgagatgcgtacgcctcctgaggatatttaaaatcacg
agggaagacaaggcctttgggtttgttgcccaggtggggtttggctcgggagtgacggac
atcaactgtgcatccggccccggggtggagggcggggtggggacagcaggagctcagccg
gcaggtgtggcctcgtcccagaccctgaccgccggggtctggagttctgtccgcatcctc
ccggccgagcagatgcccgttcagcctctagcgtctgtccaggcgctgttcaccacccgc
caaccttcctggggggagagagatcctgggacacggggccacagcggtcacagacatcag
gaccagactgacatcgagaaggacagaggtgcaggatctgcagggccttcgcatcgccct
gcccggaggctgcacctggcagctacagtcctctttggttgtgtcattcagatcctgacc
ggggaggactggaattcggtgatgtatgatgggatcatggcttatggcggcccctctttt
ccagggatgttagtctgtatttacttcatcatcctcttcatctgtggaaattatatccta
ctgaatgtgttcttggccattgccgtggacaacctggctgacgccgagagcctcacctct
gcccagaaggaggaggaagaagagaaggagaggaagaagctggccaggactgccagccca
gagaagaaacaagaggtggtggagaagccggccgtggaggagaccaaggaggagaaaatt
gagttgaaatccatcactgcggatggagagtccccccctgccaccaagatcaacatggac
gacctccagcccaacgagaatgaggacaagagttcctaccccaacccggaaaccacagga
gaagaggatgaggaggagcctgagatgcccgtgggcccccgcccacgccccctctctgag
ctgcacctgaaggagaaggcggtgcccatgccagaagccagcgccttcttcatcttcagc
ccaaacaacaggttccgtctacagtgccatcgcatcgtcaacgactccatcttcaccaac
ctgatcctcttcttcatcctgctcagcagcatctccctggctgccgaggaccccgtccag
cacacctccttcaggaaccacatcctaggcaacgcagactatgtcttcactagtatcttt
acgttagaaattatcctcaagatgaccgcctacggggccttcctgcacaagggctccttc
tgccggaactacttcaacatcctggacctgctggtggtcagcgtgtccctcatctccttc
ggcatccagtccagcgctatcaacgtggtgaagatcttgcgagtcctgagggtgctcagg
cccctgagggccatcaacagggccaaggggctgaagcacgtggtgcagtgcgtgttcgtg
gccatccgcaccatcgggaacatcgtgatcgtcaccacgctgctccagttcatgttcgcc
tgcatcggggtccagctcttcaagggcaagctctacacctgttcggacagttccaaacag
acggaggccgaatgcaaggggaactacatcacatacaaggacggggaggtggaccacccc
atcatccagccccgcagctgggagaacagcaagtttgactttgacaacgtcctggcagct
atgatggccctgttcaccgtctccacctttgaggggtggccagagctgctgtaccgctcc
atcgactcccacacggaggacaagggccccatttacaactaccgcgtggagatctccgtc
ttcttcatcatctacatcatcatcatcgccttcttcatgatgaacatcttcgtgggcttc
gtcatcgtcaccttccaggagcagggggagcaggagtacaagaactgcgagctggacaag
aatcagcggcagtgcgtggagtatgccctcaaggcccggcccctgcggaggtacatcccc
aagaaccagcaccagtacaaggtgtggtacgtggtcaactccacctacttcgagtacctg
atgttcgtcctcatcctgctcaacaccatctgcctggccatgcagcactacggtcagagc
tgcctgttcaaaatcgccatgaacgttctcaacatgctgttcaccggcctcttcacggtg
gagatgattctgaagctcatcgccttcaagcccaagggctactttagtgacccctggaat
gtctttgactgcctcatcgtaattggcagcgtaattgacgtcattctcagtgagacgaat
cactatttctgtgatgcatggaacacatttgacgccttgattgttgtgggtagcattgtt
gatatagccatcaccgaggtaaacccagctgaacatactcaatgctctccctttatgaac
gcggaagagaactcccgcatctccatcaccttcttccgcctcttccgggtcatgcgcctg
gtcaagctgctgagccgtggggagggcatccggacgctgctgtggacgttcatcaagtcc
ttccaggtaccccccggcccccctccagggaaaatatctaaaaccttgaatgcaatttgg
atgatgctgttcttcatctacgccgtgatcgggatgcaggtgttcgggaaaatcgccctg
aatgacacgacagagatcaacaggaacaacaacttccagaccttcccccaggctgtgctg
ctcctcttcaggtgcgccaccggggaggcgtggcaggacatcatgctggcctgcatgcca
ggcaagaagtgcgcccccgagtcggaaccgggcagcagcgccgagggggagacgccctgt
ggcagcagcttcgctgtcttctacttcatcagcttctacatgctctgcgcctttctgatc
atcaacctcttcgtagccgtcatcatggacaactttgactacctgacaagggactggtcc
atcctgggtccccaccatctggacgaatttaagagaatctgggcggagtatgatcctgaa
gccaagggtcgcatcaaacacctggacgtggtgaccctgctccggaggattcagccgccc
ctgggctttgggaagctgtgccctcaccgcgtggcttgcaaacgcctggtctccatgaac
atgcccctgaacagcgatgggacggtcatgttcaacgccaccctgtttgccctggtccgg
acggccctgaggatcaaaacggaagggaacctggaacaggccaacgaggagctgcgggcc
atcatcaagaagatctggaagcggaccagcatgaagctgctggaccaggtggtgccgcct
gcgggagatgacgaggtcacggtgggcaagttttacgctactttcctgatccaagagtat
ttccggaaattcaagaagcgcaaagagcagggcctggtgggcaagccctcccagaggaac
gccctgtcgctgcaggctggtctgcgcaccctgcatgacctcgggcccgagatccgccgg
gccatctccggggacctgaccgccgaagaggagctggacaaggccatgaaggaggctgtg
tccgccgcctcggaagatgacatcttcaggagggccggcggcctgttcggcaaccacgtg
ggctactaccccagcgacagccggagcgccttcccccagaccctcaccacccagcgccct
ctgcacatcagcaaggcgggcaccagccagagcgacgcggagtcgccctcccacgagaaa
ctggtggactccaccttcacccccagcagctactcgtccatgggttccaacgccaacatc
aacaacgccaacaacaccgccctgggccgctgcccccgccccgccggccagcccggtgcc
gtcagcgtcagcaccgtggagggccgtgggccccccttgtcccctgctgtccaggtgcag
ggggcctcgtggaggctcagctccaagaggtgcccctcccgggacagcctgatagccatg
gtgtgtcaggaggaggcccctcgggatgagacttgtgacctgaggacggatgaggacgcc
gagtacggcagcgagcccagcctgatctccacggagatgctctcctaccaggacgacgag
aatcggcagctggcgccccccgaggagggcaggagagacgtccgtctctctccgaagagg
ggcttcctgcgctccgcctccctaggtcgaagggcctccttccaccttgagtgtctgaag
cgacagaagaatcccgggggagacatctctcagaagacagtcctacccctgcatctcgtt
caccatcaggcgctggcggtggcgggcctgagccccctcctgcagagaagccatccccct
ggcgccctccccccgccgcatgccaccccccctgccacgccaggcccggcctggcccccg
cggcctgtgcccacactgcggctggagggggccgagtccagcgacaagctcaccagcagc
ttcccatccgtccactgcggcccctgggccggggagcccacgccctgcggggccggcggc
agcatccggagggcccggcccgtgtccctcactgtgcccagcccggcgggaccccggggc
cggcccttccacggcagcgccagcagcctggtggaggcggtcttgatctcagaaggactg
gggcggtttgctcaggatcccaagttcctcgaggccaccacccaggagctggccgacgcc
tgcgacatgaccatcgaggagatggagagcgcggccgacaacatccttagcgggggcgcc
cggcagagccccaacggcaccctgctcccgtgtgcaaactgcagggacccggggccagac
cgagaggggggcgcggaggacgcggcctgggcgcccagccccgagccccgccagggcgga
gaggagccctgggacagcagggccttcgccagcagcctgtag

DBGET integrated database retrieval system