KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103019416Help
Entry
103019416         CDS       T03086                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00052  Galactose metabolism
bacu00500  Starch and sucrose metabolism
bacu01100  Metabolic pathways
bacu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103019416 (GAA)
   00500 Starch and sucrose metabolism
    103019416 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    103019416 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacu04147]
    103019416 (GAA)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103019416 (GAA)
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103019416 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 103019416
NCBI-ProteinID: XP_007185870
UniProt: A0A384AEV1
LinkDB All DBs
Position
Un
AA seq 940 aa AA seqDB search
MPPCSCPLLGVCALVSLAILGHILLHDFDVVPRELRSFSQEEIYPARQPGASGQGPQPVP
GCHGSPRAAPTQCDLPPDGRFDCAPDKAITQEQCEARGCCYMPARWPPGTQMGQPWCFFP
PSYPSYRLENLTTTKTGYTATLIRATPTFFPKDIMTLRLDVLLETESRLHFTIKDPTNQR
YEVPLETPRVRSQAPSTLYSVEFSEEPFGMIMRRKLDGRVLLNTTVAPLFFADQFLQLST
SLPSQHITGLAEHLGPLMLSTNWTKITLWNRDVAPAPDVNLYGSHPFYLVLEDGGLAHGV
FLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPQPKSVVRQYLDIVGYPFMPPYWGLG
FHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDARRDFTFNKDGFGDFPAMVQD
LHQSGRRYIMIVDPAISSSSPAGTYRPYDEGLRRGVFITNETGQPLIGQVWPGLTAFPDF
TNPEALDWWQDMVAEFHTQVPFDGMWIDMNEPSNFVRGSVDGCPNSSLENPPYVPGVVGG
TLRAATICASGHQFLSTHYDLHNLYGLTEAFASHRALVKARGTRPFVISRSTFAGHGQYA
GHWTGDVWSSWEQLSYSVPEILLFNLLGVPLVGADICGFLGNTSEELCVRWTQLGAFYPF
MRNHNGLNSLPQEPYRFSETAQQAMRKAFALRYMLLPYLYTLFHGAHVRGETVARPLFLE
FPEDPCTWTVDHQLLWGEALLITPVLKAGKVEVTGYFPRSTWYDLQTVPVEAFGSLPPPA
PLTSAIHSEGQWVTLSAPLDTINLHLRAGHIIPMQGPGLTTTESRKKPMALAVALTASGE
ARGELFWDDGESLGVLDRGAYTQVIFLARNNTIVNQLVHVSSEGAGLQLRKVTVLGVATA
PQQVLCNGVPVSNFTYSPDTETLDIPVLLTMGEQFLISWS
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
atgccaccctgttcctgccccctgctgggggtctgcgccctagtctccttggccatcctg
gggcacatcctgcttcatgacttcgacgtggtcccccgagagctgcgcagcttctcccaa
gaggagatttacccagctcgccagcccggagccagcggccaagggccccagcccgtccca
gggtgccacggcagccccagggcagcacccacacagtgcgacctgccccccgacggccgc
ttcgactgcgccccagacaaggccatcacccaggagcagtgtgaggcccggggctgctgc
tacatgcctgcaaggtggcctccgggcacccagatggggcagccctggtgcttcttccct
cccagctatcccagttacaggctggagaacctgaccaccaccaagacgggctacacggcc
accctgatccgtgccaccccgaccttcttccccaaggacatcatgaccttgcggctggat
gtgctgctggagactgagagccggctccacttcacgatcaaagatcccaccaaccagcgc
tatgaggtgcccttggagaccccacgtgtccgcagccaggcgccgtccacgctctacagc
gtggagttctcagaggagccctttgggatgatcatgcggcggaagctggatggacgggtg
ctgctgaacaccacggtggcccccctgttcttcgccgaccagtttctgcagctgtccacc
tccctgccatcccagcacatcacgggccttgccgaacacctcgggcccctgatgctcagc
accaactggaccaagatcactctctggaaccgggacgttgcgcctgcgcccgacgtgaac
ctatatggatctcaccctttctacctggtcctggaggatggcggtttagctcacggggtc
ttcctgctgaacagcaatgccatggatgtggtcctgcagcccagcccggccctcagctgg
aggtcgacaggcgggatcctggatgtgtacatcttcctgggcccgcagcccaagagcgtg
gtgcggcagtacctggacatcgtgggctacccgttcatgccaccgtactggggcctgggc
ttccacctgtgccgctggggctactcctccaccgccatcacccgccaggttgtggagaac
atgaccagggcacacttccctctggacgtccagtggaatgacctggactacatggacgcc
aggcgggacttcactttcaacaaggacggcttcggggacttcccggccatggtgcaggat
ctccaccaaagtggccggcggtacatcatgattgttgatcctgccatcagcagctccagc
cctgccgggacctaccgaccctacgacgagggtctgaggcggggcgtcttcatcaccaat
gagactgggcagccgctgattgggcaggtgtggcccggactcaccgccttccccgacttc
accaaccccgaggcccttgactggtggcaggacatggtggccgagttccacacccaggtg
ccctttgacggcatgtggatcgacatgaacgagccatccaatttcgtgaggggctcagtg
gatggctgccccaacagcagcctggagaacccgccctacgtgccaggggtggttggcggg
accctccgggcagccaccatctgcgcctccggccaccagttcctgtccacgcactacgac
ctgcacaacctgtacggcctgaccgaagccttcgcctcccacagggctctggtaaaggct
cgggggacgcgcccctttgtgatctctcgctcaacctttgccggccacggccaatacgcc
ggccactggaccggggacgtgtggagcagctgggagcagctttcctactccgtgccagaa
atcctgctcttcaatctgctgggggtgcccctggtgggggccgacatctgtggcttcctg
ggcaacacttcggaggagctgtgtgtgcgctggacccagctgggggccttctaccccttc
atgcggaaccacaatggcctgaacagcctgccgcaggagccgtacaggttcagcgagacg
gcacagcaagccatgaggaaggcctttgccctgcgctacatgctgctgccctatctctac
acgctgttccatggggcccacgtcagaggcgagaccgtggcccggcccctcttcttggag
ttccccgaggacccctgcacctggaccgtggaccaccagctcctgtggggggaggctctg
ctcatcacaccggtgctcaaggccgggaaggttgaggtcactggctacttcccccgcagc
acgtggtacgacctgcagacggtgccagtggaggccttcggcagcctcccacctcctgca
cccctcacgtctgccatccacagcgaagggcagtgggtgacactgtccgccccactggac
accatcaacctccacctccgggccgggcacatcatccccatgcagggtcctggcctcacg
accacagagtcccgcaagaagcccatggccctggccgtggccctgactgcgagcggggag
gcccgaggggagctgttctgggacgatggggagagcctgggagtgctggaccgtggggcc
tacacgcaggtcatcttcctggccaggaacaacaccatcgtgaaccagctggtgcacgtg
agcagtgagggggctggcctgcagctgaggaaggtgaccgtcctgggggtggccacagcc
ccccagcaggtcctctgcaatggcgttcctgtatccaacttcacctacagccctgacacg
gagaccctggacatccctgtcttgctgacaatgggagagcagttcctcatcagttggtct
taa

DBGET integrated database retrieval system