KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103019528
Entry
103019528         CDS       T03086                                 

Gene name
BAX
Definition
(RefSeq) BCL2 associated X, apoptosis regulator
  KO
K02159  apoptosis regulator BAX
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu01524  Platinum drug resistance
bacu04071  Sphingolipid signaling pathway
bacu04115  p53 signaling pathway
bacu04141  Protein processing in endoplasmic reticulum
bacu04210  Apoptosis
bacu04211  Longevity regulating pathway
bacu04215  Apoptosis - multiple species
bacu04217  Necroptosis
bacu04722  Neurotrophin signaling pathway
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu05012  Parkinson disease
bacu05014  Amyotrophic lateral sclerosis
bacu05016  Huntington disease
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05132  Salmonella infection
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05203  Viral carcinogenesis
bacu05210  Colorectal cancer
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05216  Thyroid cancer
bacu05217  Basal cell carcinoma
bacu05218  Melanoma
bacu05220  Chronic myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103019528 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    103019528 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103019528 (BAX)
   04215 Apoptosis - multiple species
    103019528 (BAX)
   04217 Necroptosis
    103019528 (BAX)
   04115 p53 signaling pathway
    103019528 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103019528 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    103019528 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103019528 (BAX)
   05202 Transcriptional misregulation in cancer
    103019528 (BAX)
   05203 Viral carcinogenesis
    103019528 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103019528 (BAX)
   05212 Pancreatic cancer
    103019528 (BAX)
   05225 Hepatocellular carcinoma
    103019528 (BAX)
   05226 Gastric cancer
    103019528 (BAX)
   05214 Glioma
    103019528 (BAX)
   05216 Thyroid cancer
    103019528 (BAX)
   05220 Chronic myeloid leukemia
    103019528 (BAX)
   05217 Basal cell carcinoma
    103019528 (BAX)
   05218 Melanoma
    103019528 (BAX)
   05213 Endometrial cancer
    103019528 (BAX)
   05224 Breast cancer
    103019528 (BAX)
   05222 Small cell lung cancer
    103019528 (BAX)
   05223 Non-small cell lung cancer
    103019528 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103019528 (BAX)
   05014 Amyotrophic lateral sclerosis
    103019528 (BAX)
   05016 Huntington disease
    103019528 (BAX)
   05020 Prion disease
    103019528 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    103019528 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103019528 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103019528 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103019528 (BAX)
   05152 Tuberculosis
    103019528 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103019528 (BAX)
   05170 Human immunodeficiency virus 1 infection
    103019528 (BAX)
   05161 Hepatitis B
    103019528 (BAX)
   05160 Hepatitis C
    103019528 (BAX)
   05164 Influenza A
    103019528 (BAX)
   05162 Measles
    103019528 (BAX)
   05168 Herpes simplex virus 1 infection
    103019528 (BAX)
   05163 Human cytomegalovirus infection
    103019528 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103019528 (BAX)
   05169 Epstein-Barr virus infection
    103019528 (BAX)
   05165 Human papillomavirus infection
    103019528 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103019528 (BAX)
   01524 Platinum drug resistance
    103019528 (BAX)
   01522 Endocrine resistance
    103019528 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bacu03029]
    103019528 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bacu02000]
    103019528 (BAX)
Mitochondrial biogenesis [BR:bacu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    103019528 (BAX)
Transporters [BR:bacu02000]
 Other transporters
  Pores ion channels [TC:1]
   103019528 (BAX)
SSDB
Motif
Pfam: Bcl-2 CF222
Other DBs
NCBI-GeneID: 103019528
NCBI-ProteinID: XP_007168325
UniProt: A0A383YZM6
LinkDB
Position
Un
AA seq 192 aa
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQAPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPQLIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
NT seq 579 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcaacccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatgggggga
gagacacccgagctgggcctggagcaggcgccccaggatgcatccaccaagaagctgagc
gagtgtctcaagcgcattggagatgaactggacagtaacatggagctgcagaggatgatc
gcggccgtggacacagactccccccgagaggtctttttccgagtggcggctgaaatgttt
tctgacggcaacttcaactggggccgggttgtcgcccttttctactttgccagcaaactg
gtgctcaaggccctgtgcaccaaggtgccccagctgatcaggaccatcatgggctggaca
ctggacttccttcgagagcggctgctgggctggatccaggaccagggtggttgggacggc
ctcctctcctactttgggacacccacgtggcagacagtgaccatcttcgtggccggcgtg
ctcactgcctcgcttaccatctggaagaagatgggctga

DBGET integrated database retrieval system