KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103019793
Entry
103019793         CDS       T03086                                 

Gene name
RHOA
Definition
(RefSeq) ras homolog family member A
  KO
K04513  Ras homolog gene family, member A
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04071  Sphingolipid signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04144  Endocytosis
bacu04150  mTOR signaling pathway
bacu04270  Vascular smooth muscle contraction
bacu04310  Wnt signaling pathway
bacu04350  TGF-beta signaling pathway
bacu04360  Axon guidance
bacu04510  Focal adhesion
bacu04520  Adherens junction
bacu04530  Tight junction
bacu04611  Platelet activation
bacu04621  NOD-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04660  T cell receptor signaling pathway
bacu04670  Leukocyte transendothelial migration
bacu04722  Neurotrophin signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu04921  Oxytocin signaling pathway
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04972  Pancreatic secretion
bacu05100  Bacterial invasion of epithelial cells
bacu05132  Salmonella infection
bacu05133  Pertussis
bacu05135  Yersinia infection
bacu05152  Tuberculosis
bacu05163  Human cytomegalovirus infection
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103019793 (RHOA)
   04015 Rap1 signaling pathway
    103019793 (RHOA)
   04310 Wnt signaling pathway
    103019793 (RHOA)
   04350 TGF-beta signaling pathway
    103019793 (RHOA)
   04072 Phospholipase D signaling pathway
    103019793 (RHOA)
   04071 Sphingolipid signaling pathway
    103019793 (RHOA)
   04024 cAMP signaling pathway
    103019793 (RHOA)
   04022 cGMP-PKG signaling pathway
    103019793 (RHOA)
   04150 mTOR signaling pathway
    103019793 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103019793 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103019793 (RHOA)
   04520 Adherens junction
    103019793 (RHOA)
   04530 Tight junction
    103019793 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103019793 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103019793 (RHOA)
   04621 NOD-like receptor signaling pathway
    103019793 (RHOA)
   04625 C-type lectin receptor signaling pathway
    103019793 (RHOA)
   04660 T cell receptor signaling pathway
    103019793 (RHOA)
   04670 Leukocyte transendothelial migration
    103019793 (RHOA)
   04062 Chemokine signaling pathway
    103019793 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103019793 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    103019793 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103019793 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    103019793 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103019793 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    103019793 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103019793 (RHOA)
   05206 MicroRNAs in cancer
    103019793 (RHOA)
   05205 Proteoglycans in cancer
    103019793 (RHOA)
   05203 Viral carcinogenesis
    103019793 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103019793 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103019793 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103019793 (RHOA)
   05135 Yersinia infection
    103019793 (RHOA)
   05133 Pertussis
    103019793 (RHOA)
   05152 Tuberculosis
    103019793 (RHOA)
   05100 Bacterial invasion of epithelial cells
    103019793 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103019793 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103019793 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacu04147]
    103019793 (RHOA)
   04031 GTP-binding proteins [BR:bacu04031]
    103019793 (RHOA)
Membrane trafficking [BR:bacu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    103019793 (RHOA)
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103019793 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   103019793 (RHOA)
  Exosomal proteins of colorectal cancer cells
   103019793 (RHOA)
  Exosomal proteins of bladder cancer cells
   103019793 (RHOA)
GTP-binding proteins [BR:bacu04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    103019793 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 103019793
NCBI-ProteinID: XP_007168796
LinkDB
Position
Un
AA seq 221 aa
MLPSCTPMDCLTHSSLRNIPFRQHDFVTMAAIRKKLVIVGDGACGKTCLLIVFSKDQFPE
VYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSL
ENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIG
AFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
NT seq 666 nt   +upstreamnt  +downstreamnt
atgcttccttcatgtaccccaatggattgtctcacccactccagtttgagaaacattccc
ttcagacaacatgattttgtcacaatggctgccatccggaagaaactggtgattgttgga
gatggagcctgtggcaagacttgcttgctcattgtctttagcaaggaccagttcccagag
gtgtatgtacctacggtgtttgagaactatgtggcagatattgaagtggacggaaagcag
gtagagttggctttgtgggacacagctgggcaggaagattatgatcgcttgaggcctctc
tcctacccggatactgatgttatactgatgtgtttctccattgacagccctgatagttta
gaaaacatcccagaaaaatggactccagaagtcaagcatttctgtcccaacgtgcccatc
atcctggttgggaacaagaaggatcttcgaaatgatgagcacacaaggcgggagctagcc
aagatgaagcaggagccagtaaaaccggaagaaggcagagatatggcaaacaggattggc
gcttttgggtacatggagtgttcagcaaagaccaaagatggagtgagggaggtttttgaa
atggccacgagagctgctctgcaagccagacgtgggaagaaaaaatctgggtgccttgtc
ttgtga

DBGET integrated database retrieval system