KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103019984
Entry
103019984         CDS       T03086                                 

Gene name
IL3
Definition
(RefSeq) interleukin 3
  KO
K04736  interleukin 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04060  Cytokine-cytokine receptor interaction
bacu04151  PI3K-Akt signaling pathway
bacu04210  Apoptosis
bacu04630  JAK-STAT signaling pathway
bacu04640  Hematopoietic cell lineage
bacu04664  Fc epsilon RI signaling pathway
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05221  Acute myeloid leukemia
bacu05310  Asthma
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103019984 (IL3)
   04151 PI3K-Akt signaling pathway
    103019984 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103019984 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103019984 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103019984 (IL3)
   04664 Fc epsilon RI signaling pathway
    103019984 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103019984 (IL3)
   05202 Transcriptional misregulation in cancer
    103019984 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    103019984 (IL3)
  09163 Immune disease
   05310 Asthma
    103019984 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103019984 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103019984 (IL3)
Cytokines and growth factors [BR:bacu04052]
 Cytokines
  Interleukins
   103019984 (IL3)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Haparin
  Cytokines
   103019984 (IL3)
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 103019984
NCBI-ProteinID: XP_007188646
UniProt: A0A384AMN9
LinkDB
Position
Un
AA seq 144 aa
MSSLPILHRLLFLLALQAPQAQGATLKTPGTQQCYELNLIREITNDLDKLPVASEDSLNS
NEKRRLMETSLQRPNLEEFLTFATNSLGEDSKIMKNLKEIQPILPTAMSTKEPILIEKDN
LGDFRVKLKEYLSAIRDSLNCKNT
NT seq 435 nt   +upstreamnt  +downstreamnt
atgagcagcctccccatcctgcatcggctcctgttcctgctcgcactccaagcccctcaa
gcacaaggggcaacactcaagacaccaggaactcaacaatgctatgaactcaacctgatc
cgggaaattacaaatgatctagacaagctacctgtggcttcagaagactccttgaactca
aacgagaagaggaggctgatggaaacaagcctccagaggccaaacctggaagaattcctg
acatttgccacaaattcccttggagaggattcgaaaatcatgaaaaatcttaaggaaatc
cagccaatcctgcccacagccatgtccacgaaagagccaatccttattgagaaggataac
ttgggtgatttccgggtgaaattgaaggaatatctgtctgccattagagactctctgaat
tgtaagaacacatag

DBGET integrated database retrieval system