KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103020195Help
Entry
103020195         CDS       T03086                                 

Gene name
CHRNA10
Definition
(RefSeq) cholinergic receptor nicotinic alpha 10 subunit
  KO
K04811  nicotinic acetylcholine receptor alpha-10
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103020195 (CHRNA10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bacu04040]
    103020195 (CHRNA10)
Ion channels [BR:bacu04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   103020195 (CHRNA10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Motif
Other DBs
NCBI-GeneID: 103020195
NCBI-ProteinID: XP_007173813
UniProt: A0A383ZF71
LinkDB All DBs
Position
Un
AA seq 409 aa AA seqDB search
MGPGSHRLSLSFSVSSLGLLLLLPLLPECFGAEGRLAHKLFRDLFANYTSALRPVADTDQ
ALNVTLEVTLSQIIDMDERNQVLTLYLWIRQEWTDAYLRWDPDAYGGLDAIRIPSSLVWR
PDIILYNNKPDAHRLQGAALTSKAAAPQGAPPPARRADAQGRVLGMPARRRVLTYGCCSE
PYPDVTFTLLLRRRAAAYVCNLLLPCVLISLLAPLAFHLPADSGEKVSLGVTVLLALTVF
QLLLAESMPPAESVPLIGKYYMATMTMVTFSTALTILIMNLHYCGPSARPVPAWARALLL
GRLARGLCVRERGESCGQSRPPESAPSPQPPDREAGPPAGPCREPRCLCHQEALLRHVAT
ITNTFHRHRAAQRCHEDWKRLARVMDRFFLGIFFSMALVMSLLVLVQAL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggggcccgggagccaccgcctcagcctcagcttctctgtctccagtctgggcctcctg
ctcctgctcccactcctgccagagtgcttcggagccgagggcaggctggcacacaagctg
ttccgagacctctttgccaactacacaagtgccctgagacctgtggcagacacagaccag
gctctgaacgtgaccctggaagtgacgttgtcccagatcatcgacatggatgagcggaac
caggtgctgaccctgtacctgtggatccgacaggagtggacagatgcctacctacgatgg
gaccctgacgcctatggtggcctggatgccatccgcatccccagcagtctcgtgtggcgg
ccggacatcatactctataacaacaagcccgatgcgcaccgccttcaaggggcagccctg
acctccaaggccgcggcgcctcagggagccccaccccctgcccgcagggcggacgcgcag
gggcgcgtgctgggcatgccggcccggcggcgcgtgctcacctacggctgctgctccgag
ccctacccggacgtgaccttcacgctgctgctgcgccgccgcgccgccgcctacgtgtgc
aacctgctgctgccctgcgtgctcatctcgctgctggcgcctctggccttccacctgccc
gccgactcgggcgagaaggtgtcgctcggcgtcaccgtgctgctggcgctcaccgtcttc
cagctgctcctggccgagagcatgccgccggccgagagcgtgccgctcatcggaaagtac
tacatggccaccatgaccatggtcaccttctccacagcgctcaccatccttatcatgaac
ctgcattactgtggtcccagtgcccgcccagtgccagcctgggctcgggccctcctgctg
ggacgcctggcgcggggcctgtgtgtgcgggaacgaggggagtcctgtgggcagtctaga
cctcctgagtcagcccccagcccccagcctcctgacagagaagctggcccaccagcaggc
ccttgccgtgagcctcggtgtctgtgccaccaggaagccctgctgcgccatgtagccacc
atcaccaacaccttccacagacacagggctgcccagcgctgccatgaggactggaagcgc
ctggcccgtgtcatggaccgtttcttcctgggcatcttcttctccatggccctggtgatg
agccttctcgtgctggtgcaggccctgtga

DBGET integrated database retrieval system